DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp4g1

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster


Alignment Length:535 Identity:148/535 - (27%)
Similarity:247/535 - (46%) Gaps:65/535 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLAVGVCFWIYFLWSRR-RLYMMHFKIPGPMGLPILGIAFEYL-ITYKRKMSIRTKYMDIYGSTC 69
            |:...|...:|..|.|. |.|.|...||.|..|||||.|.... ::....:::...|::.||.|.
  Fly    31 LVGTLVAMALYEYWRRNSREYRMVANIPSPPELPILGQAHVAAGLSNAEILAVGLGYLNKYGETM 95

  Fly    70 LVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFS--KPVNSCTGDGLLSLEASKWVDRRKNLNP 132
            ..|:|....|...:|...|.|....:.|.::..:.  ||   ..|||||......|...||.:.|
  Fly    96 KAWLGNVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKP---WFGDGLLISNGHHWRHHRKMIAP 157

  Fly   133 AFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIATQTTVGTDVKK----DA 193
            .|.|::|.||:|.|...:|.:||.:....|: ...|.|.:.:.:..|...|.:|  |||    :.
  Fly   158 TFHQSILKSFVPTFVDHSKAVVARMGLEAGK-SFDVHDYMSQTTVDILLSTAMG--VKKLPEGNK 219

  Fly   194 SF----------------------KNDSVLKSYETFMKI-----IVMNVLLPFTHNKIFSTLGGF 231
            ||                      :.||:.|    |.|:     .:||::|..|...:......|
  Fly   220 SFEYAQAVVDMCDIIHKRQVKLLYRLDSIYK----FTKLREKGDRMMNIILGMTSKVVKDRKENF 280

  Fly   232 -ETQKALAKSNVNKMIGTIVDKKL--------MTKPESGSQPEITSVINKAIELHRNG--EMSRE 285
             |..:|:.:.....:..|...||.        :.:.:.|::..: ::::..:|:.:|.  |.:.:
  Fly   281 QEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRL-ALLDAMVEMAKNPDIEWNEK 344

  Fly   286 EVQSECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGD---FEVTYDDLQRM 347
            ::..|..:.:....:||......||.::.:..:.|..|:.|.|.:|   ||   .:.|:.|...|
  Fly   345 DIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIF---GDNMLRDCTFADTMEM 406

  Fly   348 VFLERVVNETLRLIPSVPFTPRETIRDFRLSSG-VVIPKGVGIGIDIFATHRNRDHWGTDPSSFN 411
            .:||||:.|||||.|.||...|....|.:|:|| ..:|||..:.:..:..||..|.: .:|:.|:
  Fly   407 KYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIY-PNPTKFD 470

  Fly   412 PDHFLPDNVRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYEDLEFVDNI 476
            ||:|||:.:.:||.|::||||.|.|:|:|.||.::..|:.||.|:||..|.::....|.:...:|
  Fly   471 PDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVHSTDTEADFKLQADI 535

  Fly   477 GMELAQSPGLEFHRR 491
            .::|.....:...:|
  Fly   536 ILKLENGFNVSLEKR 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 135/478 (28%)
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 133/474 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.