DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp4f39

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:XP_006241152.1 Gene:Cyp4f39 / 299566 RGDID:1308796 Length:550 Species:Rattus norvegicus


Alignment Length:520 Identity:127/520 - (24%)
Similarity:210/520 - (40%) Gaps:106/520 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLAVGVCFWIYFLWSRRRLYMMHFKI--------------PGPMGLP-ILGIAFEYLITYKRKMS 56
            :|:..:.|.::.|:   ||.:..||:              |.|.|.. :||....|| ..::.:.
  Rat    23 VLSALLLFLLFLLF---RLLLQAFKLFSDFRITCRRLSCFPEPPGRHWLLGHMSMYL-PNEKGLQ 83

  Fly    57 IRTKYMDIYGSTCLVWVGP-TPFVITRDPKIAEEIF-LSPECLNRSSIFSKPVNSCTGDGLLSLE 119
            ...|.:|......|.|||| .|.::...|...:.:. .|.....:...|...:....|||||..:
  Rat    84 NEKKVLDTMHHIILAWVGPFLPLLVLVHPDYIKPVLGASAAIAPKDEFFYSFLKPWLGDGLLISK 148

  Fly   120 ASKWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIATQTT 184
            .:||...|:.|.|||..::|..::.|||.....:.|                  :|...:|..:.
  Rat   149 GNKWSRHRRLLTPAFHFDILKPYMKIFNQSVNIMHA------------------KWRRHLAEGSV 195

  Fly   185 VGTDVKKDASFKN-DSVLK---SYET---------FMKIIVMNVL-----------LPFTH---- 221
            ...|:.:..|... ||:.|   ||.:         ...||.::.|           |.|.:    
  Rat   196 TSFDMFEHVSLMTLDSLQKCVFSYSSDCQEKLSDYISSIIELSALVVRRQYRLHHYLDFIYYLTA 260

  Fly   222 -----NKIFSTLGGFETQ--------------KALAKSNVNKMIGTIVDKKLMTKPESGSQPEIT 267
                 .:...|:..|.|:              :|..|:...|.: ..:|..|:.|.|.|.     
  Rat   261 DGRRFRQACDTVHNFTTEVIQQRRRALRELGAEAWLKAKQGKTL-DFIDVLLLAKDEEGK----- 319

  Fly   268 SVINKAIELHRNGEMSREEVQSECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFP 332
                         |:|.|::::|..:|:....:||...:..||..||.:||:||...:|::|:..
  Rat   320 -------------ELSDEDIRAEADTFMFEGHDTTSSGLSWALFNLAKYPEYQDKCREEIQEVMK 371

  Fly   333 VAGDFEVTYDDLQRMVFLERVVNETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATH 397
            .....|:.:|||.::.|....:.|:||..|.|....|....|.:|..|.:||||:...:.|:.||
  Rat   372 GRELEELDWDDLTQLPFTTMCIKESLRQFPPVTLISRRCTEDIKLPDGRIIPKGIICLVSIYGTH 436

  Fly   398 RNRDHWGTDPSSFNPDHFLPDNVRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKVS 462
            .|...| .|...:||..|.||..:.|.|.|::|||.|.|||||..:.:...::.::..|...::|
  Rat   437 YNPLVW-PDSKVYNPYRFDPDIPQQRSPLAFVPFSAGPRNCIGQSFAMAEMRVVVALTLLRFRLS 500

  Fly   463  462
              Rat   501  500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 120/480 (25%)
Cyp4f39XP_006241152.1 CYP4F 82..523 CDD:410772 113/457 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.