DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp4f4

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_775146.1 Gene:Cyp4f4 / 286904 RGDID:708363 Length:522 Species:Rattus norvegicus


Alignment Length:510 Identity:139/510 - (27%)
Similarity:215/510 - (42%) Gaps:93/510 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLAVGVCFWIY-------FLWSRRRLYMMHFKIP-------GPMGLPILGIAFEYLITYKRKMS 56
            |||.:|.. |:.       :::.|...::..|..|       |.:|:         :...::.:.
  Rat    21 LLLLIGAS-WLLVRVLTQTYIFYRTYQHLCDFPQPPKWNWFLGHLGM---------ITPTEQGLK 75

  Fly    57 IRTKYMDIYGSTCLVWVGP-TPFVITRDPKIAEEIF-LSPECLNRSSIFSKPVNSCTGDGLLSLE 119
            ..||.:..|....:.|:|| .|.:....|.:...:. .|.....:..||...:....|||||..:
  Rat    76 QVTKLVATYPQGFMTWLGPILPIITLCHPDVIRSVLSASASVALKEVIFYSFLKPWLGDGLLLSD 140

  Fly   120 ASKWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIATQTT 184
            ..||...|:.|.|||..|:|..::.|||.....:.|....|...|..::  |:    |:..:..|
  Rat   141 GDKWSCHRRMLTPAFHFNILKPYVKIFNDSTNIMHAKWQDLASGGSARL--DM----FKNISLMT 199

  Fly   185 VGTDVKKDASFKNDSVLKSYETFMKIIVMNVLL---------------PFTHN-----KIFSTLG 229
            :.:..|...||.::...|..|....|:.::.|:               ..|||     |....:.
  Rat   200 LDSLQKCVFSFDSNCQEKPSEYISAILELSALVAKRYQQLLLHTDSLYQLTHNGRRFHKACKLVH 264

  Fly   230 GF------------------ETQKALAKSNVNKMIGTIVDKKLMTKPESGSQPEITSVINKAIEL 276
            .|                  :..||.|:|.....|    |..|:||.|.|.              
  Rat   265 NFTDAVIQGRRRALPSQHEDDILKAKARSKTLDFI----DVLLLTKDEDGK-------------- 311

  Fly   277 HRNGEMSREEVQSECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGDFEVTY 341
                |:|.|::::|..:|:....:||...:...|..||..||:|:...||::||.......|:.:
  Rat   312 ----ELSDEDIRAEADTFMFEGHDTTASGLSWILYNLARHPEYQERCRQEVRELLRDRESTEIEW 372

  Fly   342 DDLQRMVFLERVVNETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTD 406
            |||.::.||...:.|:|||.|.|....|...:|..|..|.||||||...|:|||||.|...| .|
  Rat   373 DDLAQLPFLTMCIKESLRLHPPVTVISRRCTQDIVLPDGRVIPKGVICIINIFATHHNPTVW-PD 436

  Fly   407 PSSFNPDHFLPDNVRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKV 461
            |..::|..|.|:|::||.|.|:||||.|.|||||..:.:...|:||:..|...:|
  Rat   437 PEVYDPFRFDPENIKDRSPLAFIPFSAGPRNCIGQTFAMNEMKVALALTLLRFRV 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 132/476 (28%)
Cyp4f4NP_775146.1 CYP4F 74..515 CDD:410772 129/447 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.