DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and CYP4V2

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_997235.3 Gene:CYP4V2 / 285440 HGNCID:23198 Length:525 Species:Homo sapiens


Alignment Length:486 Identity:136/486 - (27%)
Similarity:227/486 - (46%) Gaps:68/486 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PILGIA----------FEYLITYKRKMSIRTKYMDIYGSTCLVWVGPTPFVITRDPKIAEEIFLS 93
            |::|.|          |:.:|.|..:.    ::|.:    ..:||||.|.|...:.:..|.|..|
Human    58 PLVGHALLMKPDGREFFQQIIEYTEEY----RHMPL----LKLWVGPVPMVALYNAENVEVILTS 114

  Fly    94 PECLNRSSIFSKPVNSCTGDGLLSLEASKWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLD 158
            .:.:::||:: |.:....|.|||:...:||..|||.|.|.|...:|..||.|.|.:|..||..|:
Human   115 SKQIDKSSMY-KFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLE 178

  Fly   159 SLVGQGEKKVRDDIVRWSFRIATQTTVGTDVKKDASFKNDSVLKSYETFMKIIVMNVLLPFTHNK 223
            ..:.|........|...:..|..:|.:|.::...::..::.|...|. ..::|...:.:|:....
Human   179 KHINQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYR-MSEMIFRRIKMPWLWLD 242

  Fly   224 IFSTL--GGFETQKALAKSNVNKMIGTIVDKKLMTKPES------------GSQPE--------- 265
            ::..:  .|:|.:|:|      :::.|..:..:..:...            ||.|.         
Human   243 LWYLMFKEGWEHKKSL------QILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFLD 301

  Fly   266 -ITSVINKAIELHRNGEMSREEVQSECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKE 329
             :.||.:     .....:|.|:::.|..:|:....:||...:..:|.||...||.|..|..||.:
Human   302 LLLSVTD-----DEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDD 361

  Fly   330 LFPVAGDFEVTYDDLQRMVFLERVVNETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIF 394
            :|. ..|...|.:||:::.:||.|:.|||||.||||...|....|..: :|..:.||....|..:
Human   362 VFG-KSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEV-AGYRVLKGTEAVIIPY 424

  Fly   395 ATHRNRDHWGTDPSSFNPDHFLPDNVRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNC 459
            |.||:..:: .:|..|.|:.|.|:|.:.||||||:|||.|.|||||.|:.:|..|..||.|||:.
Human   425 ALHRDPRYF-PNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHF 488

  Fly   460 KVSTSFRYEDLEFVDNIGME----LAQSPGL 486
            .:.::.:.|:|      |:|    |..|.|:
Human   489 WIESNQKREEL------GLEGQLILRPSNGI 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 129/457 (28%)
CYP4V2NP_997235.3 p450 55..517 CDD:278495 136/486 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.