DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and CYP4A22

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:527 Identity:123/527 - (23%)
Similarity:210/527 - (39%) Gaps:112/527 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLAVGVCFWIYFLWSRRRLYMMHFKIPGPMGLPILGIAFEYLITYKRKMSIRTKYMDIYGSTCL 70
            |||......:::..|..:.|.    :.|.|....:.|...|:  .:.:::....:.:..:.|.|.
Human    29 LLLIKAAQLYLHRQWLLKALQ----QFPCPPSHWLFGHIQEF--QHDQELQRIQERVKTFPSACP 87

  Fly    71 VWV-GPTPFVITRDPKIAEEI-------------FLSPECLNRSSIFSKPVNSCTGDGLLSLEAS 121
            .|: |....|...||...:.|             ||:|.               .|.|||.|...
Human    88 YWIWGGKVRVQLYDPDYMKVILGRSDPKSHGSYKFLAPR---------------IGYGLLLLNGQ 137

  Fly   122 KWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIATQTTVG 186
            .|...|:.|.|||..::|..::.:.....:.::...:.|:||       |.....|:..:..|:.
Human   138 TWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQ-------DSPLEVFQHVSLMTLD 195

  Fly   187 TDVKK----DASFKNDSVLKSYETFMKIIVMNVLL------PFTHN-KIFS-TLGGFETQKA--L 237
            |.:|.    ..|.:.|...:||  ...|..:|.|:      .|..| .|:| |..|..|.:|  |
Human   196 TIMKSAFSHQGSIQVDRNSQSY--IQAISDLNSLVFCCMRNAFHENDTIYSLTSAGRWTHRACQL 258

  Fly   238 AKSNVNKMI----------GTI-----------VDKKLMTKPESGSQPEITSVINKAIELHRNGE 281
            |..:.:::|          |.:           :|..|:.|.|:||                  .
Human   259 AHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGS------------------I 305

  Fly   282 MSREEVQSECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGD-FEVTYDDLQ 345
            :|.:::::|..:|:....:||...:...|..||..|:||:...:|:..|.   || ..:|::.|.
Human   306 LSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLL---GDGASITWNHLD 367

  Fly   346 RMVFLERVVNETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSF 410
            :|.:....:.|.|||.|.||...||.........|..:|||:.:.:.|:..|.|...| .:...|
Human   368 QMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVW-PNLEVF 431

  Fly   411 NPDHFLPDNVRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYEDLEFVDN 475
            :|..|.|.:.  :|.:|::|||.|.|||||.::.:...|:|        :..|..|:|.|.....
Human   432 DPSRFAPGSA--QHSHAFLPFSGGSRNCIGKQFAMNQLKVA--------RALTLLRFELLPDPTR 486

  Fly   476 IGMELAQ 482
            |.:.:|:
Human   487 IPIPMAR 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 112/479 (23%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 118/500 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.