DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp4a12a

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_803125.2 Gene:Cyp4a12a / 277753 MGIID:88612 Length:508 Species:Mus musculus


Alignment Length:411 Identity:106/411 - (25%)
Similarity:181/411 - (44%) Gaps:36/411 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YGSTCLVWV-GPTPFVITRDPKIAEEIF-LSPECLNRSSIFSKPVNSCTGDGLLSLEASKWVDRR 127
            :.|.|..|: |....:...||...:.|. .|....|.|..|..|   ..|.|||.|:...|...|
Mouse    80 FPSACPQWLWGSKVRIQVYDPDYMKLILGRSDPKANGSYRFLAP---WIGRGLLMLDGQTWFQHR 141

  Fly   128 KNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIATQTTVGTDVK-- 190
            :.|.|||..::|..:..|.....:.::...:.:|||       |.....||..|..|:.|.:|  
Mouse   142 RMLTPAFHYDILKPYTEIMADSVRVMLDKWEQIVGQ-------DSTLEIFRHITLMTLDTIMKCA 199

  Fly   191 --KDASFKNDSVLKSY----ETFMKIIVMNVLLPFTHNKIFSTL--GGFETQKA--LAKSNVNKM 245
              .:.|.:.|...|||    |....::...|...|..|.|...:  .|.:...|  ||..:.:::
Mouse   200 FSHEGSVQLDRKYKSYIQAVEDLNDLVFSRVRNIFHQNDIIYRVSSNGCKANSACKLAHDHTDQV 264

  Fly   246 IGT----IVDKKLMTKPESGSQPEITSVINKAIELHRNGEMSREEVQSECCSFVVAAFETTGDTV 306
            |.:    :.|::.:.|.:...:.:...::..| .:.....:|.:::::|..:|:....:||...:
Mouse   265 IKSRRIQLQDEEELEKLKKKRRLDFLDILLFA-RMENGKSLSDKDLRAEVDTFMFEGHDTTASGI 328

  Fly   307 YHALILLAMFPEHQDTVYQELKELFPVAGD-FEVTYDDLQRMVFLERVVNETLRLIPSVPFTPRE 370
            ......||..||||....:|::.|.   || ..:|::||.:|.:....:.|.||:.|.||...||
Mouse   329 SWIFYALATNPEHQQRCRKEIQSLL---GDGTSITWNDLDKMPYTTMCIKEALRIYPPVPSVSRE 390

  Fly   371 TIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPDNVRDRHPYAYIPFSKGR 435
            .........|..:|||:.:.:..:..|.|...| .:|..|:|..|.|.:  .||.::::|||.|.
Mouse   391 LSSPVTFPDGRSLPKGIHVMLSFYGLHHNPTVW-PNPEVFDPSRFAPGS--SRHSHSFLPFSGGA 452

  Fly   436 RNCIGWKYGLMSSKLALSKIL 456
            |||||.::.:...|:|::..|
Mouse   453 RNCIGKQFAMNELKVAVALTL 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 106/411 (26%)
Cyp4a12aNP_803125.2 p450 52..502 CDD:278495 106/411 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.