DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp4v3

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001129072.1 Gene:Cyp4v3 / 266761 RGDID:708530 Length:525 Species:Rattus norvegicus


Alignment Length:492 Identity:137/492 - (27%)
Similarity:220/492 - (44%) Gaps:77/492 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WSRRRLYMMHFKIPG-PMGLPILGIA----------FEYLITYKRKMSIRTKYMDIYGSTCLVWV 73
            |.:.|      .||. ....|::|.|          |:.:|.|..:.    :::.|    ..:|:
  Rat    44 WQQMR------PIPSVARAYPLVGHALFMKPNNTEFFQQIIQYTEEF----RHLPI----IKLWI 94

  Fly    74 GPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPVNSCTGDGLLSLEASKWVDRRKNLNPAFKQNV 138
            ||.|.|.....:..|.|..|.:.:::|.:: |.:....|.|||:...|||..|||.|.|:|...:
  Rat    95 GPVPLVALYKAENVEVILTSSKQIDKSFMY-KFLQPWLGLGLLTSTGSKWRARRKMLTPSFHFTI 158

  Fly   139 LLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIATQTTVGTDVKKDASFKNDSVLKS 203
            |..||.:.|.:|..||..|:..|.|........|...:..|..:|.:|.::...::..::.|...
  Rat   159 LEDFLDVMNEQANILVNKLEKHVNQEAFNCFFPITLCALDIICETAMGKNIGAQSNGDSEYVRTV 223

  Fly   204 YETFMKIIVMNVLLPF--------------THNKIFSTLGGFETQKALAKSNVNK----MIGTIV 250
            |. ...:|...:.:|:              .|.|...:|..|.......:.|..|    .||   
  Rat   224 YR-MSDMIYRRMKMPWFWFDLWYLMFKEGRDHKKGLKSLHTFTNNVIAERVNARKAEQDCIG--- 284

  Fly   251 DKKLMTKPESGSQPEITSVINKA-IEL------HRNGEMSREEVQSECCSFVVAAFETTGDTVYH 308
                     :|..|..:....|| ::|      ....::|.|:::.|..:|:....:||...:..
  Rat   285 ---------AGRGPLPSKTKRKAFLDLLLSVTDEEGNKLSHEDIREEVDTFMFEGHDTTAAAINW 340

  Fly   309 ALILLAMFPEHQDTVYQELKELF-----PVAGDFEVTYDDLQRMVFLERVVNETLRLIPSVPFTP 368
            :|.||...||.|..|.:||.::|     |      ||.:||:::.:|:.|:.||||:.||||...
  Rat   341 SLYLLGSNPEVQRKVDKELDDVFGRSHRP------VTLEDLKKLKYLDCVIKETLRVFPSVPLFA 399

  Fly   369 RETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPDNVRDRHPYAYIPFSK 433
            |....|..: :|..|.||....|..:|.||:..:: .||..|.|:.|.|:|.:.||||||:|||.
  Rat   400 RSLSEDCEV-AGYKISKGTEAVIIPYALHRDPRYF-PDPEEFQPERFFPENSQGRHPYAYVPFSA 462

  Fly   434 GRRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYEDL 470
            |.|||||.|:.:|..|..|:.|||...:.::.:.|:|
  Rat   463 GPRNCIGQKFAVMEEKTILACILREFWIESNQKREEL 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 132/470 (28%)
Cyp4v3NP_001129072.1 CYP4V 76..515 CDD:410773 129/454 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.