DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp4a8

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:XP_038965258.1 Gene:Cyp4a8 / 266674 RGDID:628846 Length:510 Species:Rattus norvegicus


Alignment Length:491 Identity:114/491 - (23%)
Similarity:200/491 - (40%) Gaps:78/491 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TFQLLLAVGVCFWIYFLWSRRRLYMMHFKIPGPMGLPILGIAFEYLITYKRKMSIRTKYMDI--- 64
            |..|||.....|:::..|..|...    :.|.|..        .:...:|....:..::.||   
  Rat    26 TVLLLLFKTAQFYLHRRWLLRATQ----QFPSPPS--------HWFFGHKLSFLVDQEFQDILTR 78

  Fly    65 ---YGSTCLVWV-GPTPFVITRDPKIAEEI-------------FLSPECLNRSSIFSKPVNSCTG 112
               :.|.|..|: |....:...||...:.|             ||:|               ..|
  Rat    79 VKNFPSACPQWLWGSNVRIQVYDPDYMKLILGRSDPKSHHSYRFLAP---------------WIG 128

  Fly   113 DGLLSLEASKWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSF 177
            .|||.|....|...|:.|.|||..:.|..::.|.....:.::...:.:|||       |.....|
  Rat   129 YGLLLLNGQTWFQHRRMLTPAFHYDTLKPYVGIMADSVRIMLDKWEQIVGQ-------DSTLEIF 186

  Fly   178 RIATQTTVGTDVK----KDASFKNDSVLKSY----ETFMKIIVMNVLLPFTHNKIFSTL--GGFE 232
            :..|..|:.|.:|    ::.|.:.|...|||    |....:....:...|..|.|..:|  .|.:
  Rat   187 QHITLMTLDTIMKCAFSQEGSVQLDRKYKSYIKAVEDLNNLSFFRIRNIFHQNDIIYSLSSNGRK 251

  Fly   233 TQKA--LAKSNVNKMI----GTIVDKKLMTKPESGSQPEITSVINKAIELHRNGEMSREEVQSEC 291
            .:.|  ||..:.:::|    ..:.|::.:.|.:...:.:...::..| .:.....:|.:::::|.
  Rat   252 ARSAWQLAHEHTDQVIKSRKAQLQDEEELQKVKQKRRLDFLDILLFA-RIENGSSLSDKDLRAEV 315

  Fly   292 CSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGD-FEVTYDDLQRMVFLERVVN 355
            .:|:....:||...:......||..||||....:|::.|.   || ..:|:|||.:|.:....:.
  Rat   316 DTFMFEGHDTTASGISWIFYALATNPEHQQGCRKEIQSLL---GDGASITWDDLDKMPYTTMCIK 377

  Fly   356 ETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPDNV 420
            |.||:.|.|....|..........|..:|||:.:.:..:..|.|...| .:|..|:|..|.|:: 
  Rat   378 EALRIYPPVTAVSRMLSTPVTFPDGRSLPKGITVMLSFYGLHHNPTVW-PNPEVFDPYRFAPES- 440

  Fly   421 RDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKIL 456
             .||.::::|||.|.|||||.::.:...|:|::..|
  Rat   441 -SRHSHSFLPFSGGARNCIGKQFAMNELKVAVALTL 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 107/461 (23%)
Cyp4a8XP_038965258.1 CYP4B-like 72..505 CDD:410771 104/433 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.