DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and CYP4Z1

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_835235.1 Gene:CYP4Z1 / 199974 HGNCID:20583 Length:505 Species:Homo sapiens


Alignment Length:496 Identity:127/496 - (25%)
Similarity:210/496 - (42%) Gaps:74/496 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLAVGVC-----FWIYFLWSRRR--LYMMHFKIPGPMGLPILGIAFEYLITYKRKMSIRTKYMDI 64
            ||.:.:|     |.:..|:.|||  :..:|. .|.|......|....|.:   ::..:..|.|:.
Human    15 LLLILLCMSLLLFQVIRLYQRRRWMIRALHL-FPAPPAHWFYGHKEFYPV---KEFEVYHKLMEK 75

  Fly    65 YGSTCLVWVGP-TPFVITRDPKIAEEIFLSPECLNRSSIFSKPVNSCTGDGLLSLEASKWVDRRK 128
            |.....:|||| |.|....||..|:.:....:  .:|::..|.:.|..|.||::|:.|||...|:
Human    76 YPCAVPLWVGPFTMFFSVHDPDYAKILLKRQD--PKSAVSHKILESWVGRGLVTLDGSKWKKHRQ 138

  Fly   129 NLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEK---------KVRDDIVRWSFRIATQTT 184
            .:.|.|..::|..|:.:.:...:.::...:..:.|..:         ...|.|::.:|       
Human   139 IVKPGFNISILKIFITMMSESVRMMLNKWEEHIAQNSRLELFQHVSLMTLDSIMKCAF------- 196

  Fly   185 VGTDVKKDASFKNDSVLKSYETFMKIIV---------MNVLLPFTHNKI---FSTLGGFETQKAL 237
                 ....|.:.||.|.||   :|.:.         ||..|  .||.:   ||:.|..      
Human   197 -----SHQGSIQLDSTLDSY---LKAVFNLSKISNQRMNNFL--HHNDLVFKFSSQGQI------ 245

  Fly   238 AKSNVNKMIGTIVDKKLMTKPESGSQPEITSVINK----------AIELHRNGEMSREEVQSECC 292
             .|..|:.:....:|.:..:.||...........|          :.:.....:.|..::|:|..
Human   246 -FSKFNQELHQFTEKVIQDRKESLKDKLKQDTTQKRRWDFLDILLSAKSENTKDFSEADLQAEVK 309

  Fly   293 SFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGD-FEVTYDDLQRMVFLERVVNE 356
            :|:.|..:||...:...|..||.:||||.....|::||.   || ..:|::.|.:|.:....:.|
Human   310 TFMFAGHDTTSSAISWILYCLAKYPEHQQRCRDEIRELL---GDGSSITWEHLSQMPYTTMCIKE 371

  Fly   357 TLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPDNVR 421
            .|||...|....|...:......|..:|.|:.:.|:|:|.|.|...| .||..|||..|..:|..
Human   372 CLRLYAPVVNISRLLDKPITFPDGRSLPAGITVFINIWALHHNPYFW-EDPQVFNPLRFSRENSE 435

  Fly   422 DRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKVS 462
            ..||||:||||.|.|||||..:.::..|:|::..|...|::
Human   436 KIHPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFKLA 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 118/463 (25%)
CYP4Z1NP_835235.1 p450 47..500 CDD:278495 118/463 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.