DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and CYP4A11

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens


Alignment Length:526 Identity:121/526 - (23%)
Similarity:212/526 - (40%) Gaps:110/526 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLAVGVCFWIYFLWSRRRLYMMHFKIPGPMGLPILGIAFEYLITYKRKMSIRTKYMDIYGSTCL 70
            |||...|..:::..|..:.|.    :.|.|....:.|...|  :...:::....|:::.:.|.|.
Human    29 LLLIKAVQLYLHRQWLLKALQ----QFPCPPSHWLFGHIQE--LQQDQELQRIQKWVETFPSACP 87

  Fly    71 VWV-GPTPFVITRDPKIAEEI-------------FLSPECLNRSSIFSKPVNSCTGDGLLSLEAS 121
            .|: |....|...||...:.|             ||:|               ..|.|||.|...
Human    88 HWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAP---------------WIGYGLLLLNGQ 137

  Fly   122 KWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEK---------KVRDDIVRWSF 177
            .|...|:.|.|||..::|..::.:.....:.::...:.|:||...         ...|.|::.:|
Human   138 TWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAF 202

  Fly   178 RIATQTTVGTDVKKDASFKNDSVLKSYETFMKIIVMNVLLPFTHN-KIFS-TLGGFETQKA--LA 238
              :.|.::..|      ..:.|.:::......::...|...|..| .|:| |..|..|.:|  ||
Human   203 --SHQGSIQVD------RNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHRACQLA 259

  Fly   239 KSNVNKMI----------GTI-----------VDKKLMTKPESGSQPEITSVINKAIELHRNGEM 282
            ..:.:::|          |.:           :|..|:.|.|:||                  .:
Human   260 HQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGS------------------IL 306

  Fly   283 SREEVQSECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGD-FEVTYDDLQR 346
            |.:::::|..:|:....:||...:...|..||..|:||:...:|:..|.   || ..:|::.|.:
Human   307 SDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLL---GDGASITWNHLDQ 368

  Fly   347 MVFLERVVNETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFN 411
            |.:....:.|.|||.|.||...||.........|..:|||:.:.:.|:..|.|...| .:|..|:
Human   369 MPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVW-PNPEVFD 432

  Fly   412 PDHFLPDNVRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYEDLEFVDNI 476
            |..|.|.:.  :|.:|::|||.|.|||||.::.:...|:|.:        .|..|:|.|.....|
Human   433 PFRFAPGSA--QHSHAFLPFSGGSRNCIGKQFAMNELKVATA--------LTLLRFELLPDPTRI 487

  Fly   477 GMELAQ 482
            .:.:|:
Human   488 PIPIAR 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 109/478 (23%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 115/499 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.