DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp4a14

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_031848.1 Gene:Cyp4a14 / 13119 MGIID:1096550 Length:507 Species:Mus musculus


Alignment Length:456 Identity:109/456 - (23%)
Similarity:179/456 - (39%) Gaps:81/456 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LVWVGPTPF------------VITRDPKIAEEIF--LSPECLNRSSIFSKPVNSCTGDGLLSLEA 120
            |:||...|.            |:..||...:.:.  ..|:.......|:..:    |.|||.|..
Mouse    73 LIWVEKFPSACLQCLSGSNIRVLLYDPDYVKVVLGRSDPKASGIYQFFAPWI----GYGLLLLNG 133

  Fly   121 SKWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIATQTTV 185
            .||...|:.|.|||..::|..::.|.......::...:.|.||       |.....|...:..|:
Mouse   134 KKWFQHRRMLTPAFHYDILKPYVKIMADSVNIMLDKWEKLDGQ-------DHPLEIFHCVSLMTL 191

  Fly   186 GTDVKKDASFKNDSVL-KSYETFMKIIVMNVLLPFTHNKIFSTLGGFETQKALAKSNVNKMIGTI 249
            .|.:|...|::....| ::.:.:.|.:           :..:.|..|..:.|..|.|:  :....
Mouse   192 DTVMKCAFSYQGSVQLDENSKLYTKAV-----------EDLNNLTFFRLRNAFYKYNI--IYNMS 243

  Fly   250 VDKKL-----------------MTKPESGSQPEITSVINKA----------IELHRNGEMSREEV 287
            .|.:|                 |.|.:..::.|:.....|.          ..:.....:|.|::
Mouse   244 SDGRLSHHACQIAHEHTDGVIKMRKSQLQNEEELQKARKKRHLDFLDILLFARMEDRNSLSDEDL 308

  Fly   288 QSECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGD-FEVTYDDLQRMVFLE 351
            ::|..:|:....:||...:......||..||||....:|::.   :.|| ..||:|.|.:|.:..
Mouse   309 RAEVDTFMFEGHDTTASGISWIFYALATHPEHQQRCREEVQS---ILGDGTSVTWDHLGQMPYTT 370

  Fly   352 RVVNETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFL 416
            ..:.|.|||.|.|....||.........|..||||:...|.|:..|.|...| .:|..|:|..|.
Mouse   371 MCIKEALRLYPPVISVSRELSSPVTFPDGRSIPKGITATISIYGLHHNPRFW-PNPKVFDPSRFA 434

  Fly   417 PDNVRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYEDLEFVDNIGMELA 481
            ||:  ..|.:||:|||.|.|||||.::.:...|:|::        .|..|:|.|.....|.:.:|
Mouse   435 PDS--SHHSHAYLPFSGGSRNCIGKQFAMNELKVAVA--------LTLLRFELLPDPTRIPVPIA 489

  Fly   482 Q 482
            :
Mouse   490 R 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 103/435 (24%)
Cyp4a14NP_031848.1 p450 52..501 CDD:278495 109/456 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.