DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp4a12b

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_758510.2 Gene:Cyp4a12b / 13118 MGIID:3611747 Length:508 Species:Mus musculus


Alignment Length:423 Identity:103/423 - (24%)
Similarity:177/423 - (41%) Gaps:60/423 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YGSTCLVWV-GPTPFVITRDPKIAEEI-------------FLSPECLNRSSIFSKPVNSCTGDGL 115
            :.|.|..|: |....:...||...:.|             ||:|               ..|.||
Mouse    80 FPSACPQWLWGSKVRIQVYDPDYMKLILGRSDPKAHGSYRFLAP---------------WIGRGL 129

  Fly   116 LSLEASKWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIA 180
            |.|:...|...|:.|.|||..::|..:..|.......::...:.:|||       |.....|:..
Mouse   130 LLLDGQTWFQHRRMLTPAFHYDILKPYTEIMADSVHVMLDKWEQIVGQ-------DSTLEIFQHI 187

  Fly   181 TQTTVGTDVK----KDASFKNDSVLKSY----ETFMKIIVMNVLLPFTHNKIF---STLGGFETQ 234
            |..|:.|.:|    .:.|.:.|...|||    |....:..:.|...|..|.|.   |:.|.....
Mouse   188 TLMTLDTIMKCAFSHEGSVQLDRKYKSYIQAVEDLNNLFFLRVRNIFHQNDIIYRVSSNGCLANS 252

  Fly   235 KA-LAKSNVNKMI----GTIVDKKLMTKPESGSQPEITSVINKAIELHRNGEMSREEVQSECCSF 294
            .. ||..:.:::|    ..:.|::.:.|.:...:.:...::..| .:.....:|.:::::|..:|
Mouse   253 ACQLAHDHTDQVIKSRRSQLQDEEELEKLKKKRRLDFLDILLFA-RMENGKSLSDKDLRAEVDTF 316

  Fly   295 VVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGD-FEVTYDDLQRMVFLERVVNETL 358
            :....:||...:......||..||||....:|::.|.   || ..:|::||.:|.:....:.|.|
Mouse   317 MFEGHDTTASGISWIFYALATNPEHQQRCRKEIQSLL---GDGASITWNDLDKMPYTTMCIKEAL 378

  Fly   359 RLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPDNVRDR 423
            |:.|.||...||.........|..:|||:.:.:..:..|.|...| .:|..|:|..|.|.:  .|
Mouse   379 RIYPPVPSVSRELSSPVTFPDGRSLPKGIHVMLSFYGLHHNPTVW-PNPEVFDPSRFAPGS--SR 440

  Fly   424 HPYAYIPFSKGRRNCIGWKYGLMSSKLALSKIL 456
            |.::::|||.|.|||||.::.:...|:|::..|
Mouse   441 HSHSFLPFSGGARNCIGKQFAMNELKVAVALTL 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 103/423 (24%)
Cyp4a12bNP_758510.2 CYP4B-like 70..503 CDD:410771 103/423 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.