DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and CYP4F8

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_009184.1 Gene:CYP4F8 / 11283 HGNCID:2648 Length:520 Species:Homo sapiens


Alignment Length:503 Identity:138/503 - (27%)
Similarity:220/503 - (43%) Gaps:69/503 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLAVG-------VCFWIY-FLWSRRRL-----------YMMHFKI--PGPMGLPILGIAFEYLI 49
            |||.||       :..|.| |..:.|||           ::.|..:  |...||.:|        
Human    21 LLLVVGASWLLARILAWTYAFYHNGRRLRCFPQPRKQNWFLGHLGLVTPTEEGLRVL-------- 77

  Fly    50 TYKRKMSIRTKYMDIYGSTCLVWVGP-TPFVITRDPKIAEEIFLSPECL-NRSSIFSKPVNSCTG 112
                     |:.:..|....:.|:|| ||.:....|.|...:..:.:.: ::..:|.|.:....|
Human    78 ---------TQLVATYPQGFVRWLGPITPIINLCHPDIVRSVINTSDAITDKDIVFYKTLKPWLG 133

  Fly   113 DGLLSLEASKWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSF 177
            ||||.....||...|:.|.|||..|:|..::.||:..|..:.|....|..:|...:  |:    |
Human   134 DGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQRLAMEGSTCL--DV----F 192

  Fly   178 RIATQTTVGTDVKKDASFKNDSVLKSYETFMKIIVMNVLLPFTHNKIFS--------TLGG---- 230
            ...:..|:.:..|...||.::...|..|....|:.::.|:...:|:.|.        |..|    
Human   193 EHISLMTLDSLQKCIFSFDSNCQEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFH 257

  Fly   231 ------FETQKALAKSNVNKMIGTIVDKKLMTKPESGSQPEITSVINKAIELHRNG-EMSREEVQ 288
                  .:...|:.:.....:....||..|..|.:|.:...|..::   :...:|| |:|.|:::
Human   258 RACRLVHDFTDAVIQERRRTLTSQGVDDFLQAKAKSKTLDFIDVLL---LSEDKNGKELSDEDIR 319

  Fly   289 SECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGDFEVTYDDLQRMVFLERV 353
            :|..:|:....:||...:...|..||..||:|:...||::||.......|:.:|||.::.||...
Human   320 AEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMC 384

  Fly   354 VNETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPD 418
            :.|:|||.|.:|...|...:|..|....|||||....|:|||.|.|...| .||..::|..|.|:
Human   385 LKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVCNINIFAIHHNPSVW-PDPEVYDPFRFDPE 448

  Fly   419 NVRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTSFR 466
            |.:.|.|.|:||||.|.|||||.|:.:...|:.|:..|...::....|
Human   449 NAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRFRILPDHR 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 125/450 (28%)
CYP4F8NP_009184.1 p450 52..504 CDD:306555 127/472 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.