DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and CYP4F2

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens


Alignment Length:421 Identity:107/421 - (25%)
Similarity:189/421 - (44%) Gaps:45/421 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 YMAWIG-TTPIVITRDPKIAEKVLTSPFCI-NRSSQTTNALALSMGYGLLTLQGSKWMARRKHMN 131
            :..|:| .:|::....|.|...|:.:...| .:.....:.|...:|.|||...|.||...|:.:.
Human    88 FKVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFFYSFLEPWLGDGLLLSAGDKWSRHRRMLT 152

  Fly   132 PAFKHSVLLSFLPIFNAETDLLVSVFDSFVGQGEK--DVLSDLIRWSFAIATQTTLGTDVTKDDN 194
            |||..::|..::.|||...:::.:.:.....:|..  |:...:     ::.|..:|...|...|:
Human   153 PAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSACLDMFEHI-----SLMTLDSLQKCVFSFDS 212

  Fly   195 FENDAILKTYQSMLRLTIINIFVPFVQNKIVSK-----LFGLEWLR---------RRDASAINKM 245
            ...:...:...::|.|           :.:|||     |..:::|.         ||....::..
Human   213 HCQEKPSEYIAAILEL-----------SALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLVHDF 266

  Fly   246 INNILDKKLNSNPEN------YCESELKTVIHRAIELFRNDE----MSLMELGAECSSMVLAAFE 300
            .:.::.::..:.|..      ..:::.||:....:.|...||    :|..::.||..:.:....:
Human   267 TDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHD 331

  Fly   301 TSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTHTDLQQLVYLDRVLNETLRLMPSVP 365
            |:|..:.:.|..||..||:||....|::|.....:..|:...||..|.:|...:.|:|||.|.||
Human   332 TTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVP 396

  Fly   366 FSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQFNPENFLPEKIHDRHPYAFIP 430
            ..||...:|:.|.:|.|||||:...|.:|.|..|...| .:...::|..|.||.|.:|.|.||||
Human   397 VISRHVTQDIVLPDGRVIPKGIICLISVFGTHHNPAVW-PDPEVYDPFRFDPENIKERSPLAFIP 460

  Fly   431 FSKGKRNCIGWRYGLMSSKLALVKILRNYKL 461
            ||.|.|||||..:.:...|:.|...|..:::
Human   461 FSAGPRNCIGQTFAMAEMKVVLALTLLRFRV 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 107/421 (25%)
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724
p450 52..515 CDD:365848 107/421 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.