DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and CYP72C1

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:315 Identity:72/315 - (22%)
Similarity:117/315 - (37%) Gaps:90/315 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIVIQLLIAASLILW--IRFLWSRRKLYMLMMQLPGRMGLPLLGNSVRYLIISRGRMSSRTTYMD 63
            :.:|..||.....:|  :.::|.|.|.....::..|     ..|||.|.|:   |.| ..:..||
plant    10 VFLIGFLILILNWVWRAVNWVWLRPKRLEKYLKKQG-----FSGNSYRILM---GDM-RESNQMD 65

  Fly    64 ---------------------------KHGSTYMAWIGTTPIVITRDPKIAEKVLTSPFCINRSS 101
                                       |||.....|.|..|.||..||:...::::......:..
plant    66 QVAHSLPLPLDADFLPRMMPFLHHTVLKHGKKCFTWYGPYPNVIVMDPETLREIMSKHELFPKPK 130

  Fly   102 -QTTNALALSMGYGLLTLQGSKWMARRKHMNPAFKHSVLLSFLPIFNAETDLLVSVFDSFVGQGE 165
             .:.|.:.||   |||..:|.||...|..:||||:...|.|.||.||:..               
plant   131 IGSHNHVFLS---GLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSC--------------- 177

  Fly   166 KDVLSDLIRWSFAIATQT----TLGTDVTKD--------DNFEND-AILKTYQSMLRLTIINIFV 217
            |::|.:..|.:.|..|..    |...|:|::        |::::. .|.:..|..:.|.::.|..
plant   178 KEMLEEWERLASAKGTMELDSWTHCHDLTRNMLARASFGDSYKDGIKIFEIQQEQIDLGLLAIRA 242

  Fly   218 PFVQNKIVSKLFGLEWLRR-----RDASAINKMINNILDKKLNSNPENYCESELK 267
            .::..   ||....::.||     ||..|   |...:::.|         |.|:|
plant   243 VYIPG---SKFLPTKFNRRLRETERDMRA---MFKAMIETK---------EEEIK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 65/281 (23%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.