DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and CYP94B1

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001331365.1 Gene:CYP94B1 / 836464 AraportID:AT5G63450 Length:568 Species:Arabidopsis thaliana


Alignment Length:451 Identity:95/451 - (21%)
Similarity:170/451 - (37%) Gaps:70/451 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VITRDPKIAEKVL-TSPFCINRSSQTTNALALSMGYGLLTLQGSKWMARRKHMNPAFKHSVLLSF 142
            :||.:|:..|.:| |:.:...:....|:.|...:|.|:....|..|.::||..:..|....|..|
plant   142 IITANPENVEHILKTNFYNFPKGKPFTDLLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREF 206

  Fly   143 -LPIFNAET-DLLVSVFDSFVGQGEK-DVLSDLIRWSFAIATQTTLGTDVTKDDNFENDAILKTY 204
             ..|...|. :.|:.|..|.|..||. |....|.|::|.:..:.:||.|        .|.:..|.
plant   207 TFEILREEVQNRLIPVLSSAVDCGETVDFQEVLKRFAFDVVCKVSLGWD--------PDCLDLTR 263

  Fly   205 QSMLRLTIINIFVPFVQNKIVSKLFGLEWLRRRDASAINKMINNILDKKLNSNPENYCESELKTV 269
            .....:...::.......:....::.: |..:|               .||...|......:|||
plant   264 PVPELVKAFDVAAEISARRATEPVYAV-WKVKR---------------FLNVGSEKRLREAIKTV 312

  Fly   270 IHRAIELFRNDEMSLMELGAECS------------------------SMVLAAFETSAHTVYYAL 310
            .....|:.|..:.|| ::|.:.|                        |.::|..:|::..:.:..
plant   313 HLSVSEIIRAKKKSL-DIGGDVSDKQDLLSRFLAAGHGEEAVRDSVISFIMAGRDTTSAAMTWLF 376

  Fly   311 VLLAMFPEHQEMVFNEIKEHFPLAKGIEVTHTDLQQLVYLDRVLNETLRLMPSVPFSSRETLEDL 375
            .||:...:.:..:.:|::....|..|.|    ||:::.|....|.|.:||.|.|.:.|:....|.
plant   377 WLLSQNDDVETKILDELRNKGSLGLGFE----DLREMSYTKACLCEAMRLYPPVAWDSKHAANDD 437

  Fly   376 RLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQFNPENFLPEK--------IHDRHPYAFIPFS 432
            .|.:|..:.||..::...:...|....||.:..:|.|..:..|:        :.....:.|..|.
plant   438 ILPDGTPLKKGDKVTYFPYGMGRMEKVWGKDWDEFKPNRWFEEEPSYGTKPVLKSVSSFKFPVFQ 502

  Fly   433 KGKRNCIGWRYGLMSSKLALVKILRNYKLKTSFPYENLE--FVDHMVIKLAQSPQLAFERR 491
            .|.|.|||........|..:..:|..:|:   .|..|..  ||..:...:|...::..:||
plant   503 AGPRVCIGKEMAFTQMKYVVGSVLSRFKI---IPVCNNRPVFVPLLTAHMAGGLKVKIKRR 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 88/419 (21%)
CYP94B1NP_001331365.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.