DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and CYP709B3

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_194501.1 Gene:CYP709B3 / 828885 AraportID:AT4G27710 Length:518 Species:Arabidopsis thaliana


Alignment Length:448 Identity:118/448 - (26%)
Similarity:201/448 - (44%) Gaps:69/448 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YMDKHGSTYMAWIGTTPIVITRDPKIAEKVLTSPFCINRSSQTTNALALSMGYGLLTLQGSKWMA 125
            :|.::|.|::.|.||.|.:...:.::|::||:|.|...........:.:..|.||..:||..|:.
plant    90 WMSQYGDTFLFWTGTKPTIYISNHELAKQVLSSKFGFTIIPVKRPEVFILFGKGLSFIQGDDWIR 154

  Fly   126 RRKHMNPAFKHSVLLSF--------LPIF--------NAETDLLVSVFDSFVGQGEKDVLSDLIR 174
            .|:.:||||....|.:.        |.||        |.|..:.:.:...|     ..:.:|:|.
plant   155 HRRILNPAFSMDRLKAMTQPMGDCTLRIFEEWRKQRRNGEVLIKIEISKEF-----HKLTADIIA 214

  Fly   175 WSFAIATQTTLGTDVTKDDNFENDAILKTYQSMLRLTIINIFVP---FVQNKIVSKLFGLEWLRR 236
             :.|..:....|.::.:...    .:.|.|.|    ::.|:|:|   ::......||:.|.    
plant   215 -TTAFGSSYAEGIELCRSQT----ELEKYYIS----SLTNVFIPGTQYLPTPTNLKLWELH---- 266

  Fly   237 RDASAINKMINNILDKKLNSNPENYCESE--LKTVIHRAIELFRNDEMSLMELGAECSSMVLAAF 299
               ..:...|..|:|.:|.|..:.|...:  |..::..|.......:|.:.|:..||.:...|..
plant   267 ---KKVKNSIKRIIDSRLKSKCKTYGYGDDLLGVMLTAAKSNEYERKMRMDEIIEECKNFYYAGQ 328

  Fly   300 ETSAHTVYYALVLLAMFPEHQ-------EMVFNEI-KEHFPLAKGIEVTHTD-LQQLVYLDRVLN 355
            .|::..:.:..:||::   ||       |.||||. |:..|        .|| ..:|..::.||.
plant   329 GTTSILLTWTTMLLSL---HQGWQEKLREEVFNECGKDKIP--------DTDTFSKLKLMNMVLM 382

  Fly   356 ETLRLMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQFNP---ENFLP 417
            |:|||...|...|||..:|:::.: :.||||.:|.|.:....|:...||.:|.||||   ||.:.
plant   383 ESLRLYGPVIKISREATQDMKVGH-LEIPKGTSIIIPLLKMHRDKAIWGEDAEQFNPLRFENGIS 446

  Fly   418 EKIHDRHPYAFIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKLKTSFPYENLEFVDH 475
            :.  ..||.|.:|||.|.|.||...:.::.:|..|..||:.::|..|..|::.. |||
plant   447 QA--TIHPNALLPFSIGPRACIAKNFAMVEAKTVLTMILQQFQLSLSPEYKHTP-VDH 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 113/434 (26%)
CYP709B3NP_194501.1 p450 9..517 CDD:299894 118/448 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.