DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and CYP72A8

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_188080.1 Gene:CYP72A8 / 820690 AraportID:AT3G14620 Length:515 Species:Arabidopsis thaliana


Alignment Length:530 Identity:119/530 - (22%)
Similarity:210/530 - (39%) Gaps:81/530 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IVIQLLIAASLILWI----RFLWSRRKLYMLMMQLPGRMGLP---LLGNSVRYLIISRGRMSSRT 59
            :...:::..::.:||    ...|.|.|.....::..|..|.|   |:|:..|...:.....|...
plant    11 VAAAVVVVTTVTVWIWKGLNVAWLRPKKNEAYLKRQGLSGTPFTFLVGDIKREASMVEQEKSRPI 75

  Fly    60 TYMD---------------KHGSTYMAWIGTTPIVITRDPKIAEKVLTSPFCINRSSQTTNALAL 109
            ...|               .||.|...|:|....||...|:..:.||...:  :......:.:..
plant    76 NLTDDYTHRVMPLIQQTVKDHGKTSYMWMGPIASVIVTKPEHIKDVLNRVY--DFPKPPVHPIVE 138

  Fly   110 SMGYGLLTLQGSKWMARRKHMNPAFKHSVLLSFLPIFNAETDLLVSVFDSFV-GQGEK------- 166
            ....|:...:|.||...||.:||:|....|...:|.|......::|.::..| .||..       
plant   139 LFATGVALYEGEKWSKHRKIINPSFHLEKLKIMIPAFYESCSEMISKWEKLVTEQGSSNEIDVWP 203

  Fly   167 ---DVLSDLI-RWSFAIATQTTLGTDVTKDDNFENDAILKTYQSMLRLTII----------NIFV 217
               |:.||:| |.:|..:.:.  |..:.:....:...:||.    |.|..|          |:.:
plant   204 YLGDLTSDVISRTAFGSSYEE--GKRIFELQEEQGRRVLKA----LELAFIPGMRFLPTKNNLRM 262

  Fly   218 PFVQNKIVSKLFGLEWLRRRDASAINKMINNILDKKLNSNPENYCESELKTVIHRAIELFRNDEM 282
            ..:..::.|:|..:...|:|.........|::|...|.||..::                   .|
plant   263 RQINKEVKSRLREIIMKRQRGMDTGEAPKNDLLGILLESNSGDH-------------------GM 308

  Fly   283 SLMELGAECSSMVLAAFETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTHTDLQQL 347
            |:.::..||.....|..||:|..:.:.:::|:...:.|:....||.:  .:.|..:.....|.:|
plant   309 SIEDVVEECRLFHFAGQETTAVLLVWTMIMLSHHQKWQDQAREEILK--VIGKNNKPNFDALSRL 371

  Fly   348 VYLDRVLNETLRLMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQFNP 412
            ..:..:|||.|||.|......|...::.:|...:.:|.|..:.|.:....|:.:.||.:..:|||
plant   372 KTMSMILNEVLRLYPPGILLGRTVEKETKLGEDMTLPGGAQVVIPVLMVHRDPELWGEDVHEFNP 436

  Fly   413 ENFLPEKIH--DRHPYAFIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKLKTSFPYENLEFVDH 475
            |.| .:.|.  .::..:|:||..|.|.|.|..:.||.:|:|||.||:.:..:.|..|.:   ..|
plant   437 ERF-ADGISKATKNQVSFLPFGWGPRFCPGQNFALMEAKMALVLILQRFSFELSPSYTH---APH 497

  Fly   476 MVIKLAQSPQ 485
            .|:.|  .||
plant   498 TVLTL--HPQ 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 107/471 (23%)
CYP72A8NP_188080.1 p450 26..515 CDD:299894 117/515 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.