DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and Cyp4f18

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_077764.2 Gene:Cyp4f18 / 72054 MGIID:1919304 Length:524 Species:Mus musculus


Alignment Length:424 Identity:106/424 - (25%)
Similarity:182/424 - (42%) Gaps:57/424 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 WIGTT-PIVITRDPKIAEKVLTSPFCI-NRSSQTTNALALSMGYGLLTLQGSKWMARRKHMNPAF 134
            |:|.. |::....|...:.|:.:|..: .:.:.....|...:|.|||...|.||...|:.:.|||
Mouse    91 WVGPLHPVIRIFHPAFIKPVVLAPALVAPKDTVFYRFLKPWLGDGLLMSTGDKWSRHRRMLTPAF 155

  Fly   135 KHSVLLSFLPIFNAETDLLVSVFDSFVGQGEK-------------DVLSDLIRWSFAIATQTTLG 186
            ..::|..::.:||..|:::.:.:.....:|..             |.|...: :||....|....
Mouse   156 HFNILKPYVKVFNDSTNIMHAKWQRLASKGSAYLNMFEHISLMTLDSLQKCV-FSFDSNCQEKPS 219

  Fly   187 TDVTKDDNFENDAILKTYQSMLR-----LTIINIFVPFVQNKIVSKLFGLEWLRRRDASAINKMI 246
            ..:|        |||:....:.|     |..:::|.....          :.:|.|.|.   :::
Mouse   220 EYIT--------AILELSTLVARRHQRLLLHVDLFYYLTH----------DGMRFRKAC---RLV 263

  Fly   247 NNILDKKLNSNPENY----------CESELKTVIHRAIELFRNDE----MSLMELGAECSSMVLA 297
            ::..|..:.......          .:::.||:....:.|...||    :|..::.||..:.:..
Mouse   264 HDFTDAVIRERRRTLLDQGGVDVLKAKAKAKTLDFIDVLLLSKDEHGKALSDEDIRAEADTFMFG 328

  Fly   298 AFETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTHTDLQQLVYLDRVLNETLRLMP 362
            ..:|:|..:.:.|..||..||:||....|::|.....:..|:...||.||.:|...:.|:|||.|
Mouse   329 GHDTTASGLSWILYNLARHPEYQERCRQEVRELLRDREPEEIEWDDLAQLPFLTMCIKESLRLHP 393

  Fly   363 SVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQFNPENFLPEKIHDRHPYA 427
            .|...||...:|:.|.:|.|||||:...|.||.|..|...| .:...::|..|..:.:..|.|.|
Mouse   394 PVTAISRCCTQDIVLPDGRVIPKGVISRISIFGTHHNPAVW-PDPEVYDPFRFDADNVKGRSPLA 457

  Fly   428 FIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKL 461
            |||||.|.|||||..:.:...|:||...|..:::
Mouse   458 FIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRV 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 106/424 (25%)
Cyp4f18NP_077764.2 p450 52..516 CDD:365848 106/424 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.