DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and CYP4F12

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_076433.3 Gene:CYP4F12 / 66002 HGNCID:18857 Length:524 Species:Homo sapiens


Alignment Length:529 Identity:130/529 - (24%)
Similarity:210/529 - (39%) Gaps:102/529 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIVIQLLIAASLILWIRFLWSRRKLYMLMMQLP------GRMGLPLLGNSVRYLIISRGRMSSRT 59
            ::|:...:.|.::.|....::..:......|.|      |.:||         :..:...:.:.|
Human    23 LLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWFWGHLGL---------ITPTEEGLKNST 78

  Fly    60 TYMDKHGSTYMAWIGTTPIVITRDPKIAEKVLTSPFCINRSSQTTNALALS-----------MGY 113
            .....:...:..|:|  ||:    |.|   ||..|..|...:..:.|:|..           :|.
Human    79 QMSATYSQGFTVWLG--PII----PFI---VLCHPDTIRSITNASAAIAPKDNLFIRFLKPWLGE 134

  Fly   114 GLLTLQGSKWMARRKHMNPAFKHSVLLSFLPIFNAETDLLVSVFDSFVGQGEK------------ 166
            |:|...|.||...|:.:.|||..::|.|::.|||...::::..:.....:|..            
Human   135 GILLSGGDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQHLASEGSSRLDMFEHISLMT 199

  Fly   167 -DVLSDLI---------RWSFAIATQTTLGTDVTKDDNFENDAILKTYQSMLRLT---------- 211
             |.|...|         |.|..|||...|...|.|    .:..||:....:..|:          
Human   200 LDSLQKCIFSFDSHCQERPSEYIATILELSALVEK----RSQHILQHMDFLYYLSHDGRRFHRAC 260

  Fly   212 -IINIFVPFVQNKIVSKLFGLEWLRRRDASAINKMINNILDKKLNSNPENYCESELKTVIHRAIE 275
             :::.|...|             :|.|..:...:.|::....|..|          ||:....:.
Human   261 RLVHDFTDAV-------------IRERRRTLPTQGIDDFFKDKAKS----------KTLDFIDVL 302

  Fly   276 LFRNDE----MSLMELGAECSSMVLAAFETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKG 336
            |...||    :|..::.||..:.:....:|:|..:.:.|..||..||:||....|::|.......
Human   303 LLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDRDP 367

  Fly   337 IEVTHTDLQQLVYLDRVLNETLRLMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTD 401
            .|:...||.||.:|...:.|:|||.|..||.||...:|:.|.:|.|||||:|..|||.....|..
Human   368 KEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITCLIDIIGVHHNPT 432

  Fly   402 YWGSEAAQFNPENFLPEKIHDRHPYAFIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKLKTSF- 465
            .| .:...::|..|.||....|.|.||||||.|.|||||..:.:...|:.|..:|.:::..... 
Human   433 VW-PDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHT 496

  Fly   466 -PYENLEFV 473
             |...||.:
Human   497 EPRRKLELI 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 123/483 (25%)
CYP4F12NP_076433.3 p450 52..506 CDD:306555 127/500 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.