DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and CYP4F11

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001122404.1 Gene:CYP4F11 / 57834 HGNCID:13265 Length:524 Species:Homo sapiens


Alignment Length:490 Identity:121/490 - (24%)
Similarity:212/490 - (43%) Gaps:49/490 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VIQLLIAASLIL-----WIRFLWSRRKLYMLMMQLP------GRMGLPLLGNSVRYLIISRGRMS 56
            ::.||:..|.:|     |....:...:......|.|      |..||         :..:...|.
Human    20 LLLLLVGGSWLLARVLAWTYTFYDNCRRLQCFPQPPKQNWFWGHQGL---------VTPTEEGMK 75

  Fly    57 SRTTYMDKHGSTYMAWIGTT-PIVITRDPKIAEKVLTSPFCINRSSQT-TNALALSMGYGLLTLQ 119
            :.|..:..:...:..|:|.| |::|...|.|...:.::...:...... ...|...:|.|||...
Human    76 TLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPKDMIFYGFLKPWLGDGLLLSG 140

  Fly   120 GSKWMARRKHMNPAFKHSVLLSFLPIFNAETDLLVSVFDSFVGQGEKDVLSDLIRWSFAIATQTT 184
            |.||...|:.:.|||..::|..::.|||...:::...:.....:|...:  |:.. ..::.|..:
Human   141 GDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQRLASEGSARL--DMFE-HISLMTLDS 202

  Fly   185 LGTDVTKDDNFENDAILKTYQSMLRLTIINIFVPFVQNKIVSKLFGLEWLR------RRDASAIN 243
            |...|.   :||::...|..:.:..:..::.||.....:|:.....|.:|.      ||....::
Human   203 LQKCVF---SFESNCQEKPSEYIAAILELSAFVEKRNQQILLHTDFLYYLTPDGQRFRRACHLVH 264

  Fly   244 KMINNILDKKLNSNP--------ENYCESELKTVIHRAIELFRND----EMSLMELGAECSSMVL 296
            ...:.::.::..:.|        :|..:|  ||:....:.|...|    |:|..::.||..:.:.
Human   265 DFTDAVIQERRCTLPTQGIDDFLKNKAKS--KTLDFIDVLLLSKDEDGKELSDEDIRAEADTFMF 327

  Fly   297 AAFETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTHTDLQQLVYLDRVLNETLRLM 361
            ...:|:|..:.:.|..||..||:||....|::|.....:.||:...||.||.:|...:.|:|||.
Human   328 EGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQELLKDREPIEIEWDDLAQLPFLTMCIKESLRLH 392

  Fly   362 PSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQFNPENFLPEKIHDRHPY 426
            |.||..||...:|..|.:|.|||||:...|:|.....|...| .:...::|..|..|.|.:|.|.
Human   393 PPVPVISRCCTQDFVLPDGRVIPKGIVCLINIIGIHYNPTVW-PDPEVYDPFRFDQENIKERSPL 456

  Fly   427 AFIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKL 461
            ||||||.|.|||||..:.:...|:.|...|.::::
Human   457 AFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFRI 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 115/455 (25%)
CYP4F11NP_001122404.1 p450 52..506 CDD:365848 116/458 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.