DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and Cyp4f40

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_038935701.1 Gene:Cyp4f40 / 503122 RGDID:1559596 Length:530 Species:Rattus norvegicus


Alignment Length:455 Identity:117/455 - (25%)
Similarity:194/455 - (42%) Gaps:78/455 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 MSSRTTYMDKHGSTYMAWIG-TTPIVITRDPKIAEKVLTSPFCI-NRSSQTTNALALSMGYGLLT 117
            |...|..:..:...:|.|:| ..|::....|.|...||::...: .:.....:.|...:|.|||.
  Rat    74 MKQMTELVATYPQGFMTWLGPIVPLITLCHPDIIRSVLSASAAVAPKDGIFYSFLKPWLGDGLLV 138

  Fly   118 LQGSKWMARRKHMNPAFKHSVLLSFLPIFNAETDLL--------------VSVFDSFVGQGEKDV 168
            ....||...|..:.|||..::|..::.|||..|:::              :.:|:: :.....|.
  Rat   139 SASDKWSRHRSMLTPAFHFNILKPYVKIFNDSTNIMHAKWLRLASGGSAHLDMFEN-ISLMTLDT 202

  Fly   169 LSDLIRWSF----------AIATQTTLGTDVTKDDNFENDAILKTYQSMLRLT-----------I 212
            |...: :||          .||....|...|.|    .|:.:|.....:.|||           :
  Rat   203 LQKCV-FSFNSNCQEKPSEYIAAILELSALVVK----RNEQLLLHMDLLYRLTPDGRRFYKACHL 262

  Fly   213 INIFVPFV---QNKIVSKLFGLEWLRRRDASAINKMINNILDKKLNSNPENYCESELKTVIHRAI 274
            ::.|...|   :.:.:.|..|.:.::   |.|.:|.: :.:|..|.|..|:              
  Rat   263 VHDFTYAVIQERRRTLPKHGGDDVIK---AKAKSKTL-DFIDVLLLSKDED-------------- 309

  Fly   275 ELFRNDEMSLMELGAECSSMVLAAFETSAHTVYYALVLLAMFPEHQEMVFNEIK--------EHF 331
                ..|:|..::.||..:.:....:|:|..:.:.|..||..||:||....|::        |..
  Rat   310 ----GKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLAKHPEYQERCRQEVQELLRDRDSEEI 370

  Fly   332 PLAKGIEVTHTDLQQLVYLDRVLNETLRLMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNT 396
            ..:.|: :...||.||.:|...:.|:|||.|.|...||...:|:.|.:|.|||||:...|:||.|
  Rat   371 ECSCGV-LLRDDLAQLPFLTMCIKESLRLHPPVTMVSRCCTQDISLPDGRVIPKGIICIINIFAT 434

  Fly   397 QRNTDYWGSEAAQFNPENFLPEKIHDRHPYAFIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKL 461
            ..|...| .:...::|..|.||.|..|.|.||||||.|.|||||..:.:...|:|:...|..:::
  Rat   435 HHNPTVW-QDPEVYDPFRFDPENIQARSPLAFIPFSAGPRNCIGQTFAMNEMKVAVALTLLRFRV 498

  Fly   462  461
              Rat   499  498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 117/455 (26%)
Cyp4f40XP_038935701.1 CYP4F 74..522 CDD:410772 117/455 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.