DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and Cyp4e1

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster


Alignment Length:534 Identity:140/534 - (26%)
Similarity:232/534 - (43%) Gaps:115/534 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IVIQLLIAASLILWIRFLWS--RRKLYMLMMQLPGRMGLPLLGNSVRYLIISRGRMSSRTT---- 60
            ||:...:|..|.|...|...  |||..:...|.|..  |||:||:        .:|.:..|    
  Fly     3 IVLCAFLALPLFLVTYFELGLLRRKRMLNKFQGPSM--LPLVGNA--------HQMGNTPTEILN 57

  Fly    61 ----YMDKHG-STYMAWIGTTPIVITRDPKIAEKVLTSPFCINRSSQTTNALALS---MGYGLLT 117
                :..::| ..:..|||....::..:||..|.:|:|...|::|    :...|:   :|.||||
  Fly    58 RFFGWWHEYGKDNFRYWIGYYSNIMVTNPKYMEFILSSQTLISKS----DVYDLTHPWLGLGLLT 118

  Fly   118 LQGSKWMARRKHMNPAFKHSVLLSFLPIFNAET----DLLVSVFDS---FVGQGEKDVLS-DLIR 174
            ..||||...||.:.|||..::|..|..:.|..:    |.|..|.|.   |..|.|...|: |:| 
  Fly   119 STGSKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIDQLKKVADGGNIFDFQEEAHYLTLDVI- 182

  Fly   175 WSFAIATQTTLGTDVTKDDNFENDAILKTYQSMLRLTIINIFVPFVQNK---------------- 223
                  ..|.:|..:...:| .:.::::.::.:.....:..|.|:.:||                
  Fly   183 ------CDTAMGVSINAMEN-RSSSVVQAFKDITYTIKMRAFSPWKRNKYLFHFAPEYPEYSKTL 240

  Fly   224 ---------IVSKLF-----GLEWLRRRDASAINKM--INNILDKKLNSNPENYCESELKTVIHR 272
                     |::|..     |||...:.|..:..||  ::.:|..|::..|              
  Fly   241 KTLQDFTNEIIAKRIEVRKSGLEVGIKADEFSRKKMAFLDTLLSSKVDGRP-------------- 291

  Fly   273 AIELFRNDEMSLMELGAECSSMVLAAFETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGI 337
                     ::..||..|.|:.:....:|:...|.:|:.||:..|:.||.:|||..:... |.|:
  Fly   292 ---------LTSQELYEEVSTFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMG-ASGL 346

  Fly   338 --EVTHTDLQQLVYLDRVLNETLRLMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNT 400
              :.|..::..:.:||..:.|..||.|||||..|.|.:|. :.:|.::|||.|:::.:.....| 
  Fly   347 GRDATFQEISTMKHLDLFIKEAQRLYPSVPFIGRFTEKDY-VIDGDIVPKGTTLNLGLLMLGYN- 409

  Fly   401 DYWGSEAAQFNPENFLPEKIHDRHPYAFIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKLKTSF 465
            |....:..:|.||.|..||   ..|:.::|||.|.|||||.::.|:..|..:.||:||       
  Fly   410 DRVFKDPHKFQPERFDREK---PGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRN------- 464

  Fly   466 PYENLEFVDHMVIK 479
             :|.|..:|.:|.|
  Fly   465 -FEVLPALDELVSK 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 125/483 (26%)
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 127/493 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.