DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and Cyp12a5

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster


Alignment Length:456 Identity:104/456 - (22%)
Similarity:183/456 - (40%) Gaps:99/456 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IGTTPIVITRDPKIAEKVLTS----PF----CINRSSQTTNALALSMG-YGLLTLQGSKWMARRK 128
            :|...:|:|.:||..|.|..:    ||    .|.|..:|........| .|::..||..|...|.
  Fly    95 MGRDGLVMTHNPKDFEVVFRNEGVWPFRPGSDILRYHRTVYRKDFFDGVQGIIPSQGKSWGDFRS 159

  Fly   129 HMNPAFKH--SVLLSF--LPIFNAE-TDLLVSVFDSFVGQGEKDVLSDLIRWSF----AIATQTT 184
            .:||....  :|.|.|  :...|.| .:|:..:.|:...:...:.|..:.||:.    .:|....
  Fly   160 IVNPVLMQPKNVRLYFKKMSQVNQEFVELIKEIRDASTQEVPGNFLETINRWTLESVSVVALDKQ 224

  Fly   185 LG--------TDVTK-----DDNFENDAILKTYQSMLRLTIINIFVPFVQNKIVSKLFGLEWLRR 236
            ||        ::.||     |:.|.:.|.|:...|:.|         :.:..::.|:     ||.
  Fly   225 LGLLRESGKNSEATKLFKYLDEFFLHSADLEMKPSLWR---------YFKTPLLKKM-----LRT 275

  Fly   237 RDASAINKMINNILDKKLNSNPENYCESELKTVIHRAIELFRNDEMSLME---------LGAECS 292
            .|  ::.::....:|:.:..     .|.|.|..:.|.     ..|.|::|         ......
  Fly   276 MD--SVQEVTLKYVDEAIER-----LEKEAKEGVVRP-----EHEQSVLEKLLKVDKKVATVMAM 328

  Fly   293 SMVLAAFETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTHTDLQQLVYLDRVLNET 357
            .|::|..:|::.|....|:.||..||.|..:..|:.:..| .|..|.|...::.:.||...:.|:
  Fly   329 DMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLP-NKDSEFTEASMKNVPYLRACIKES 392

  Fly   358 LRLMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQFNPENFLPEK--- 419
            .|:.|.|..::|....|..:| |..:|.|..:|:...|:..:.:|:.      .|..||||:   
  Fly   393 QRVYPLVIGNARGLTRDSVIS-GYRVPAGTIVSMIPINSLYSEEYFP------KPTEFLPERWLR 450

  Fly   420 -------------IHDRHPYAFIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKLKTSFPYENLE 471
                         :..::|:.|:||..|.|.|:|.|...|..:|...:::||:         |:|
  Fly   451 NASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNF---------NVE 506

  Fly   472 F 472
            |
  Fly   507 F 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 101/445 (23%)
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 104/456 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442739
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.