DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and CYP4F3

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:510 Identity:125/510 - (24%)
Similarity:211/510 - (41%) Gaps:89/510 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VIQLLIAASLILWIRFLWS-----------------RRKLYMLMMQLPGRMGLPLLGNSVRYLII 50
            ::.||:.||.:|.....|:                 :|..::      |.:|  |:.:|...|:.
Human    20 LLLLLVGASWLLARILAWTYTFYDNCCRLRCFPQPPKRNWFL------GHLG--LIHSSEEGLLY 76

  Fly    51 SRGRMSSRTTYMDKHGSTYMAWIGT-TPIVITRDPKIAEKVLTSPFCI-NRSSQTTNALALSMGY 113
            ::   |...|:    |.....|:|. ..||....|...:.||.:|..| .:.....:.|...:|.
Human    77 TQ---SLACTF----GDMCCWWVGPWHAIVRIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGD 134

  Fly   114 GLLTLQGSKWMARRKHMNPAFKHSVLLSFLPIFNAETDLLVSVFDSFVGQGEKDV---------- 168
            |||...|.||...|:.:.|||..::|..::.|||...:::.:.:.....:|...:          
Human   135 GLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLMT 199

  Fly   169 LSDLIRWSFA------------IATQTTLGTDVTKDDNFENDAILKTYQSMLRLTIINIFVPFVQ 221
            |..|.:..|:            ||....|...|||          :..|.:|.:..:....|..|
Human   200 LDSLQKCVFSFDSHCQEKPSEYIAAILELSALVTK----------RHQQILLYIDFLYYLTPDGQ 254

  Fly   222 NKIVSKLFGLEWLRRRDASAINKMINNILDKKLNSNPEN------YCESELKTVIHRAIELFRND 280
            .            .||....::...:.::.::..:.|..      ..:::.||:....:.|...|
Human   255 R------------FRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKD 307

  Fly   281 E----MSLMELGAECSSMVLAAFETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTH 341
            |    :|..::.||..:.:....:|:|..:.:.|..||..||:||....|::|.....:..|:..
Human   308 EDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEW 372

  Fly   342 TDLQQLVYLDRVLNETLRLMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSE 406
            .||.||.:|...:.|:|||.|.||..||...:|:.|.:|.|||||:...|.:|.|..|...| .:
Human   373 DDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIICLISVFGTHHNPAVW-PD 436

  Fly   407 AAQFNPENFLPEKIHDRHPYAFIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKL 461
            ...::|..|.|:.|.:|.|.||||||.|.|||||..:.:...|:.|...|..:::
Human   437 PEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRV 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 118/463 (25%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 119/478 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.