DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and Cyp46a1

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_006240610.1 Gene:Cyp46a1 / 362782 RGDID:1306605 Length:500 Species:Rattus norvegicus


Alignment Length:421 Identity:96/421 - (22%)
Similarity:188/421 - (44%) Gaps:76/421 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TPIVITRDPKIAEKVLTSPFCINRSSQTTNALALSMGYGLLTLQG-------SKWMARRKHMNPA 133
            |.:::|....:.:.::::.:  |:.|:...|:....|..|.. ||       .:|..:|:.|:.|
  Rat    83 TSVIVTSPESVKKFLMSTKY--NKDSKMYRAIQTVFGERLFG-QGLVSECDYGRWYKQRRVMDLA 144

  Fly   134 FKHSVLLSFLPIFNAETDLLVSVFDSFV-GQ---GEKDVLS----DLI-RWSFAIATQTTLGTDV 189
            |..|.|:|.:..||.:.:.|:.:.::.. ||   ..:|:|:    |:: :.:|.:.|...||.. 
  Rat   145 FSRSSLVSLMGTFNEKAEQLMEILEAKADGQTPVSMQDMLTCATIDILAKAAFGMETSMLLGAQ- 208

  Fly   190 TKDDNFENDAILKTYQSMLRLTIINI---------FVPFVQNKI--------VSKLFGLEWL-RR 236
                        |.....:::.:..|         |:|..:.::        :.:..|.:|: ||
  Rat   209 ------------KPLSQAVKVMLEGISASRNTLAKFMPGKRKQLREIRESIRLLRQVGKDWVQRR 261

  Fly   237 RDASAINKMINNILDKKLNSNPENYCESELKTVIHRAIELFRNDEMSLMELGAECSSMVLAAFET 301
            |:|.           |:....|     :::.|.|.:|.|..::||:.|...    .:..:|..||
  Rat   262 REAL-----------KRGEDVP-----ADILTQILKAEEGAQDDEVLLDNF----VTFFIAGHET 306

  Fly   302 SAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTHTDLQQLVYLDRVLNETLRLMPSVPF 366
            ||:.:.:.::.|:..||....:..|:.|.....:.::  :.||.:|.||.:||.|:|||.|.. :
  Rat   307 SANHLAFTVMELSRQPEIVARLQAEVDEVVGSKRHLD--YEDLGRLQYLSQVLKESLRLYPPA-W 368

  Fly   367 SSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQFNPENFLPEKIHDRHPYAFIPF 431
            .:...||:..|.:||.:|....:....:...|...|: .:...|||:.|.|.....|  :.:.||
  Rat   369 GTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYF-EDPLTFNPDRFGPGAPKPR--FTYFPF 430

  Fly   432 SKGKRNCIGWRYGLMSSKLALVKILRNYKLK 462
            |.|.|:|||.::..|..|:.:.|:|:..:.:
  Rat   431 SLGHRSCIGQQFAQMEVKVVMAKLLQRLEFR 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 96/421 (23%)
Cyp46a1XP_006240610.1 p450 34..466 CDD:278495 96/421 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.