DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and Cyp4ad1

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster


Alignment Length:511 Identity:105/511 - (20%)
Similarity:197/511 - (38%) Gaps:95/511 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIVIQLLIAASLIL-WIRFLWSRRKLYMLMMQLPGRMGLPLLGNSVRYLIISRGRMSSRTTYMDK 64
            :|.|.:::|..|:. .:|.......:..:|..:||....|.:||..::.:...........|..|
  Fly     3 LIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQFGLKPAEYPKKVLQYCRK 67

  Fly    65 HGSTYMAWIGTTPIVITR------DPKIAEKVLTSPFCINRSSQTTNALALSMGYGLLTLQGSKW 123
            :.     :.|...:|..:      ||...:.:|:|...:.: ....:.|...:|.||||..|::|
  Fly    68 YD-----FQGFRSLVFLQYHMMLSDPAEIQNILSSSSLLYK-EHLYSFLRPWLGDGLLTSSGARW 126

  Fly   124 MARRKHMNPAFKHSVLLSFLPIFNAETDLLVSVFDSFVGQGEKDVLSD----------LIRWSFA 178
            :..:|...|||:.|.:..:|.:.:......|.         :.|||||          :.:.:..
  Fly   127 LKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQ---------KLDVLSDTQEVFDAQELVAKCTLD 182

  Fly   179 IATQTTLGTDVTKDDNFEND-----------------AILKTYQSMLRLTIINIFVPFVQNKIVS 226
            |..:...|.|.:..:...:|                 :|:|.:.::.|||               
  Fly   183 IVCENATGQDSSSLNGETSDLHGAIKDLCDVVQERTFSIVKRFDALFRLT--------------- 232

  Fly   227 KLFGLEWLRRRDASAINKMINNILDKKLNS-NPENYCESE-------LKTVIHRAIELFRNDEMS 283
               .....:||..|.:...:|.|:.::.:. ..||.|:..       |..::...::.....|..
  Fly   233 ---SYYMKQRRALSLLRSELNRIISQRRHQLAAENTCQQGQPINKPFLDVLLTAKLDGKVLKERE 294

  Fly   284 LMELGAECSSMVLAAFETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTHTDLQQLV 348
            ::|   |.|:.:....:..|..:.:.|..|:...|.|:....|.:..|......|.....|.|:.
  Fly   295 IIE---EVSTFIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGEADLARLDQMH 356

  Fly   349 YLDRVLNETLRLMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQFNPE 413
            ||:.::.|||||.||||..:|.....:.: ||..:.|..|:.:.:.....|..|: .:...|.||
  Fly   357 YLELIIRETLRLYPSVPLIARTNRNPIDI-NGTKVAKCTTVIMCLIAMGYNEKYF-DDPCTFRPE 419

  Fly   414 NFLPEKIHDRHP--------YAFIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKL 461
            .|       .:|        :..:|||.|.|.||..::.:...|..|.::||.:::
  Fly   420 RF-------ENPTGNVGIEAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLLRRFEI 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 99/478 (21%)
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 99/478 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.