DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and Cyp4f4

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_775146.1 Gene:Cyp4f4 / 286904 RGDID:708363 Length:522 Species:Rattus norvegicus


Alignment Length:511 Identity:136/511 - (26%)
Similarity:222/511 - (43%) Gaps:91/511 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VIQLLIAASLILWIRFL---WSRRKLYMLMMQLP---------GRMGLPLLGNSVRYLIISRGRM 55
            ::.|||.||.:| :|.|   :...:.|..:...|         |.:|:         :..:...:
  Rat    20 LLLLLIGASWLL-VRVLTQTYIFYRTYQHLCDFPQPPKWNWFLGHLGM---------ITPTEQGL 74

  Fly    56 SSRTTYMDKHGSTYMAWIG-TTPIVITRDPKIAEKVLTSPFCINRSSQTTNALALS--------- 110
            ...|..:..:...:|.|:| ..||:....|.:...||::          :.::||.         
  Rat    75 KQVTKLVATYPQGFMTWLGPILPIITLCHPDVIRSVLSA----------SASVALKEVIFYSFLK 129

  Fly   111 --MGYGLLTLQGSKWMARRKHMNPAFKHSVLLSFLPIFNAETDLLVSVFDSFVGQGEKDVLSDLI 173
              :|.|||...|.||...|:.:.|||..::|..::.|||..|:::.:.:......|...:  |:.
  Rat   130 PWLGDGLLLSDGDKWSCHRRMLTPAFHFNILKPYVKIFNDSTNIMHAKWQDLASGGSARL--DMF 192

  Fly   174 RWSFAIATQTTLGTDV-TKDDNFEN------DAIL-------KTYQSMLRLTIINIFVPFVQNKI 224
            : :.::.|..:|...| :.|.|.:.      .|||       |.||.:|..|             
  Rat   193 K-NISLMTLDSLQKCVFSFDSNCQEKPSEYISAILELSALVAKRYQQLLLHT------------- 243

  Fly   225 VSKLFGLEWLRRRDASAINKMINNILD-------KKLNSNPEN---YCESELKTVIHRAIELFRN 279
             ..|:.|....||...|. |:::|..|       :.|.|..|:   ..::..||:....:.|...
  Rat   244 -DSLYQLTHNGRRFHKAC-KLVHNFTDAVIQGRRRALPSQHEDDILKAKARSKTLDFIDVLLLTK 306

  Fly   280 D----EMSLMELGAECSSMVLAAFETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVT 340
            |    |:|..::.||..:.:....:|:|..:.:.|..||..||:||....|::|.....:..|:.
  Rat   307 DEDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLARHPEYQERCRQEVRELLRDRESTEIE 371

  Fly   341 HTDLQQLVYLDRVLNETLRLMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGS 405
            ..||.||.:|...:.|:|||.|.|...||...:|:.|.:|.|||||:...|:||.|..|...| .
  Rat   372 WDDLAQLPFLTMCIKESLRLHPPVTVISRRCTQDIVLPDGRVIPKGVICIINIFATHHNPTVW-P 435

  Fly   406 EAAQFNPENFLPEKIHDRHPYAFIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKL 461
            :...::|..|.||.|.||.|.||||||.|.|||||..:.:...|:||...|..:::
  Rat   436 DPEVYDPFRFDPENIKDRSPLAFIPFSAGPRNCIGQTFAMNEMKVALALTLLRFRV 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 127/478 (27%)
Cyp4f4NP_775146.1 CYP4F 74..515 CDD:410772 124/447 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.