DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_663708.1 Gene:Cyp4x1 / 246767 RGDID:628719 Length:507 Species:Rattus norvegicus


Alignment Length:547 Identity:129/547 - (23%)
Similarity:213/547 - (38%) Gaps:141/547 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IQLLIAASLILW--IRFLWSRRKLYMLMMQLPGRMGLPLLGNSVRYLIISRGRMSSRTTYMDKHG 66
            :.|:...:|:|.  ::....|::|...:...||.....|||:.   ..:....|......:.::.
  Rat    16 LALVFCLALVLMQAVKLYLRRQRLLRDLRPFPGPTAHWLLGHQ---KFLQEDNMEKLDEIVKEYP 77

  Fly    67 STYMAWIGT------------TPIVITR-DPKIAE-KVLTSPFCINRSSQTTNALALSMGYGLLT 117
            ..:..|:|.            ..|.::| |||... ..|.:||               :|.|||.
  Rat    78 CAFPCWVGPFQAFFYIYDPDYAKIFLSRTDPKTQYLHQLMTPF---------------LGRGLLN 127

  Fly   118 LQGSKWMARRKHMNPAFKHSVLLSFLPIFNAETDLLVSVFDSFVGQGEKDVLSDLIRWSFAIATQ 182
            |.|.:|...|..:.|||...:|...:       |::....:..:.:.||              |.
  Rat   128 LDGPRWFQHRCLLTPAFHQDILKPCV-------DMMAHSVNMMLDKWEK--------------TW 171

  Fly   183 TTLGTDVTKDDNFEN------DAILK-------------TYQSMLRLTIINIFVPFVQNKIVSKL 228
            ||..|.:   :.||:      |.|:|             ||:|.::.|       |...:|:|..
  Rat   172 TTQETTI---EVFEHINLMTLDIIMKCAFGQETNCQINGTYESYVKAT-------FELGEIISSR 226

  Fly   229 FGLEWLRRRDASAINKMINNILDKKLNSNPENYCESELKTVIHRAIELFRNDEMSLM-------- 285
            ....|..           ::|:.|   .:|:.:|..||..|||:..|....|....:        
  Rat   227 LYNFWHH-----------HDIIFK---LSPKGHCFQELGKVIHQCTEKIIQDRKKTLKDQVNQDD 277

  Fly   286 -------------------------ELGAECSSMVLAAFETSAHTVYYALVLLAMFPEHQEMVFN 325
                                     :|.:|.::.:.|..:.||.::.:.|..||:.||||:....
  Rat   278 TQTSQNFLDIVLSAQAGDEKAFSDADLRSEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRT 342

  Fly   326 EIKEHFPLAKGIEVTHTDLQQLVYLDRVLNETLRLMPSVPFSSRETLEDLRLSNGVVIPKGMTIS 390
            ||:.  .|..|..:|...|.::.|....:.|||||:|.:|..|||..:.|.|.:|..:|.|||:.
  Rat   343 EIRS--ILGDGSSITWEQLDEIPYTTMCIKETLRLIPPIPSISRELSKPLTLPDGHSLPAGMTVV 405

  Fly   391 IDIFNTQRNTDYWGSEAAQFNPENFLPEKIHDRHPYAFIPFSKGKRNCIGWRYGLMSSKLALVKI 455
            :.|:....|...| .:...|:|..|..|....|||.||:|||.|.|||||.::.::..|:|:...
  Rat   406 LSIWGLHHNPAVW-KDPKVFDPLRFTKENSEQRHPCAFLPFSSGPRNCIGQQFAMLELKVAIALT 469

  Fly   456 LRNYKLK---TSFPYENLEFVDHMVIK 479
            |..:::.   |..|    .|..|.|::
  Rat   470 LLRFRVAADLTRPP----AFSSHTVLR 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 119/498 (24%)
Cyp4x1NP_663708.1 CYP4B-like 66..500 CDD:410771 119/494 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.