DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and Cyp12d1-p

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001286304.1 Gene:Cyp12d1-p / 246648 FlyBaseID:FBgn0050489 Length:521 Species:Drosophila melanogaster


Alignment Length:420 Identity:91/420 - (21%)
Similarity:167/420 - (39%) Gaps:91/420 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 GLLTLQGSKWMARRKHMNPAF--KHSVLLSFLPIFNAETDLL-----------VSVFDSFVGQGE 165
            ||:..|...|...|..:||.|  ...:.:.:.|:.|...:.:           :.|.:.|.    
  Fly   139 GLVASQNEAWGKLRSAINPIFMQPRGLRMYYEPLSNINNEFIERIKEIRDPKTLEVPEDFT---- 199

  Fly   166 KDVLSDLIRWSFA-IATQTTLGTDVTKDDNFENDAILKTYQSMLRLTIINIFVPFVQNKIVSKLF 229
             |.:|.|:..|.. :|....:|......||.:...:.:|.:.:.|||......|.:...|.:..:
  Fly   200 -DEISRLVFESLGLVAFDRQMGLIRKNRDNSDALTLFQTSRDIFRLTFKLDIQPSMWKIISTPTY 263

  Fly   230 GLEWLRRRDASAINKMIN----------NILDK------KLNSNP--ENYCESELKTVIHRAIEL 276
                  |:....:|..:|          :.|:|      |:|||.  |...|.:.|..:..::: 
  Fly   264 ------RKMKRTLNDSLNVAQKMLKENQDALEKRRQAGEKINSNSMLERLMEIDPKVAVIMSLD- 321

  Fly   277 FRNDEMSLMELGAECSSMVLAAFETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTH 341
                   ::..|.:.::.:|:|          .|:.|:..|:.|..:..|:....| .|...:..
  Fly   322 -------ILFAGVDATATLLSA----------VLLCLSKHPDKQAKLREELLSIMP-TKDSLLNE 368

  Fly   342 TDLQQLVYLDRVLNETLRLMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSE 406
            .:::.:.||..|:.||||..|:...:.|....|:.|| |..:|||.|:.:......:...|:.  
  Fly   369 ENMKDMPYLRAVIKETLRYYPNGLGTMRTCQNDVILS-GYRVPKGTTVLLGSNVLMKEATYYP-- 430

  Fly   407 AAQFNPENFLPEK-IHDRH--------PYAFIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKLK 462
                .|:.||||: :.|..        |:.|:||..|.|.|||.|...:..:..:.|::||:.::
  Fly   431 ----RPDEFLPERWLRDPETGKKMQVSPFTFLPFGFGPRMCIGKRVVDLEMETTVAKLIRNFHVE 491

  Fly   463 ----TSFPYENLEFVDHMVIKLAQSPQLAF 488
                .|.|::.: ||        ..|.:.|
  Fly   492 FNRDASRPFKTM-FV--------MEPAITF 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 85/393 (22%)
Cyp12d1-pNP_001286304.1 p450 70..508 CDD:299894 89/414 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442760
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.