DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and Cyp26b1

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001171184.1 Gene:Cyp26b1 / 232174 MGIID:2176159 Length:512 Species:Mus musculus


Alignment Length:526 Identity:124/526 - (23%)
Similarity:217/526 - (41%) Gaps:110/526 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIVIQLLIAASLILWIRFLWSRRKLYMLMMQLP-GRMGLPLLGNSVRYLIISRGRMSSRTTYMDK 64
            ::.:.||:|.|..|| :..|:..:.....:.:| |.||.||:|.:..:|:...|..|||   .:|
Mouse    19 LVSVTLLLAVSQQLW-QLRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGSGFQSSR---REK 79

  Fly    65 HGSTYMA-------------------WIGTTPIVITRDPKIAEKVLTSPFCINRSSQTTNALALS 110
            :|:.:..                   .:|...:|.|..|:.| :||..|          |.:|.|
Mouse    80 YGNVFKTHLLGRPLIRVTGAENVRKILLGEHQLVSTEWPRSA-RVLLGP----------NTVANS 133

  Fly   111 MGYGLLTLQGSKWMARRKHMNPAFKHSVLLSFLPIFNAETDLLV-SVFDSFVGQGEK-DVLSDLI 173
            :|    .:..:|    ||..:..|.|..|.|:||    :..|:: ....::..|.|. :|..:..
Mouse   134 IG----DIHRNK----RKVFSKIFSHEALESYLP----KIQLVIQDTLRAWSSQPEAINVYQEAQ 186

  Fly   174 RWSFAIATQTTLGTDVTKDDNFENDAILKTYQSMLRLTIINIF-----VPF------VQ-NKIVS 226
            |.:|.:|.:..||..:.::|   ...:.:.||..:.    |:|     :||      :| .:|:.
Mouse   187 RLTFRMAVRVLLGFSIPEED---LGHLFEVYQQFVE----NVFSLPVDLPFSGYRRGIQARQILQ 244

  Fly   227 KLFGLE-WLRRRDASAINKMINNILDKKLNSNPENYCESELKTVIHRAIELFRNDEMSLMELGAE 290
            |  ||| .:|.:......|..::.||..:.|:.|:                  ..||::.||...
Mouse   245 K--GLEKAIREKLQCTQGKDYSDALDILIESSKEH------------------GKEMTMQELKDG 289

  Fly   291 CSSMVLAAFETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGI----------EVTHTDLQ 345
            ...::.||:.|:|......::.|...|...|.:..|::     |:|:          .:....|.
Mouse   290 TLELIFAAYATTASASTSLIMQLLKHPAVLEKLREELR-----AQGLLHGGGCPCEGTLRLDTLS 349

  Fly   346 QLVYLDRVLNETLRLMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQF 410
            .|.|||.|:.|.:||...|....|..|:...| :|..||||.::...|.:|......: .:...|
Mouse   350 SLRYLDCVIKEVMRLFTPVSGGYRTVLQTFEL-DGFQIPKGWSVMYSIRDTHDTAPVF-KDVNVF 412

  Fly   411 NPENFLPEKIHDRH-PYAFIPFSKGKRNCIGWRYGLMSSKLALVKI--LRNYKLKT-SFPYENLE 471
            :|:.|...:..|:. .:.::||..|.|.|:|.....:..|:..|::  ...::|.| :||...|.
Mouse   413 DPDRFSQARSEDKDGRFHYLPFGGGVRTCLGKHLAKLFLKVLAVELASTSRFELATRTFPRITLV 477

  Fly   472 FVDHMV 477
            .|.|.|
Mouse   478 PVLHPV 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 110/477 (23%)
Cyp26b1NP_001171184.1 CYP26B1 60..490 CDD:410730 111/484 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.