DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and Cyp4f13

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_570952.1 Gene:Cyp4f13 / 170716 MGIID:2158641 Length:523 Species:Mus musculus


Alignment Length:478 Identity:123/478 - (25%)
Similarity:201/478 - (42%) Gaps:41/478 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IAASLILWIRFLWSRRKLYMLMMQLP------GRMGLPLLGNSVRYLIISRGRMSSRTTYMDKHG 66
            |.|.::.||...:..........|.|      |.:.|..........|...|.        |.| 
Mouse    30 ILARILAWIYAFYDNCSRLRCFPQPPKPSWFWGHLALMKNNEESMQFITHLGH--------DFH- 85

  Fly    67 STYMAWIGTT-PIVITRDPKIAEKVLTSPFCINRSSQTT-NALALSMGYGLLTLQGSKWMARRKH 129
            ..:::|:|.. ||:....|.....:|.:...:.....|. ..|...:|.|||...|.||...|:.
Mouse    86 DVHLSWVGPVYPILRLVHPNFIAPLLQASAAVAPKEMTLYGFLKPWLGDGLLMSAGDKWSHHRRL 150

  Fly   130 MNPAFKHSVLLSFLPIFNAETDLLVSVFDSFVGQGEKDVLSDLIRWSFAIATQTTLGTDVTKDDN 194
            :.|||...:|.|::.|||...:::.:.:.....:|...:  |:.. ..::.|..:|...:...|:
Mouse   151 LTPAFHFDILKSYVKIFNKSVNIMHAKWQCLASKGTSRL--DMFE-HISLMTLDSLQKCIFSVDS 212

  Fly   195 FENDAILKTYQSMLRLTIINI---FVPFVQNKIVSKLFGLEWLRRRDASAINKMINNILD----- 251
            ...::..|...::|.|:.:.:   ..||:   .:..|:.|....||...|.: :::|..|     
Mouse   213 NCQESDSKYIAAILELSSLVVKRHRQPFL---YLDLLYYLTADGRRFRKACD-LVHNFTDAVIKE 273

  Fly   252 --KKLNSNPENYCESELKTVIHRAIE--LFRNDE----MSLMELGAECSSMVLAAFETSAHTVYY 308
              ..||:....:.:::.||.....|:  |...||    :|..::.||..:.:....:|:...:.:
Mouse   274 RRSTLNTQGVEFLKAKAKTKTLDFIDVLLMAEDEHGKGLSNEDIRAEADTFMFGGHDTTTSALSW 338

  Fly   309 ALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTHTDLQQLVYLDRVLNETLRLMPSVPFSSRETLE 373
            .|..||..||:||....|::|........|:...||.||.:|...:.|:|||.|.|...||...:
Mouse   339 ILYNLARHPEYQERCRQEVQELLRDRDSEEIEWDDLAQLPFLTMCIKESLRLHPPVLLISRCCTQ 403

  Fly   374 DLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQFNPENFLPEKIHDRHPYAFIPFSKGKRNC 438
            |:.|.:|..||||....|.||....|...| .:...:||..|.||....|.|.||||||.|.|||
Mouse   404 DVLLPDGRAIPKGNICVISIFGVHHNPSVW-PDPEVYNPFRFDPENPQKRSPLAFIPFSAGTRNC 467

  Fly   439 IGWRYGLMSSKLALVKILRNYKL 461
            ||..:.:...|:||...|..:::
Mouse   468 IGQTFAMSEIKVALALTLLRFRI 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 118/453 (26%)
Cyp4f13NP_570952.1 p450 52..513 CDD:278495 119/456 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.