DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and CYP4A11

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens


Alignment Length:527 Identity:125/527 - (23%)
Similarity:204/527 - (38%) Gaps:78/527 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLIAASLILWIRFLWSRRKLYM-------LMMQLPGRMGLPLLGNSVRYLIISRGRMSSRTTYMD 63
            :|.||||::.:..|....:||:       .:.|.|......|.|:             .:....|
Human    18 ILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGH-------------IQELQQD 69

  Fly    64 KHGSTYMAWIGTTPI------------VITRDPKIAEKVL--TSPFCINRSSQTTNALALSMGYG 114
            :.......|:.|.|.            |...||...:.:|  :.|    :|..:...||..:|||
Human    70 QELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDP----KSHGSYRFLAPWIGYG 130

  Fly   115 LLTLQGSKWMARRKHMNPAFKHSVLLSFLPIFNAETDLLVSVFDSFVGQGEKDVLSDLIRWSFAI 179
            ||.|.|..|...|:.:.|||.:.:|..::.:......:::..::..:||       |.....|..
Human   131 LLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQ-------DSPLEVFQH 188

  Fly   180 ATQTTLGT----------DVTKDDNFENDAILKTYQSMLRLTIINIFVPFVQNKIVSKLFGL-EW 233
            .:..||.|          .:..|.|  :.:.::....:..|....:...|.||..:..|... .|
Human   189 VSLMTLDTIMKCAFSHQGSIQVDRN--SQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRW 251

  Fly   234 LRRRDASAINKMINNILDKKLNSNPENYCESELKTVIH----RAIELFRNDEMSLM---ELGAEC 291
            ..|....|.......|..:|.....|...| ::|...|    ..:.|.:.:..|::   :|.||.
Human   252 THRACQLAHQHTDQVIQLRKAQLQKEGELE-KIKRKRHLDFLDILLLAKMENGSILSDKDLRAEV 315

  Fly   292 SSMVLAAFETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTHTDLQQLVYLDRVLNE 356
            .:.:....:|:|..:.:.|..||..|:|||....||  |..|..|..:|...|.|:.|....:.|
Human   316 DTFMFEGHDTTASGISWILYALATHPKHQERCREEI--HSLLGDGASITWNHLDQMPYTTMCIKE 378

  Fly   357 TLRLMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQFNPENFLPEKIH 421
            .|||.|.||...||....:...:|..:|||:.:.:.|:....|...|.:... |:|..|.|... 
Human   379 ALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPEV-FDPFRFAPGSA- 441

  Fly   422 DRHPYAFIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKL---KTSFPYENLEFVDHMVIKLAQS 483
             :|.:||:|||.|.|||||.::.:...|:|....|..::|   .|..|..    :..:|:|....
Human   442 -QHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIP----IARLVLKSKNG 501

  Fly   484 PQLAFER 490
            ..|...|
Human   502 IHLRLRR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 110/464 (24%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 114/488 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.