DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a2 and Cyp4a10

DIOPT Version :9

Sequence 1:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_034141.3 Gene:Cyp4a10 / 13117 MGIID:88611 Length:509 Species:Mus musculus


Alignment Length:417 Identity:102/417 - (24%)
Similarity:176/417 - (42%) Gaps:42/417 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 STYMAWI-GTTPIVITRDPKIAEKVLTSPFCINRSSQTTNA----LALSMGYGLLTLQGSKWMAR 126
            |.:..|. |:...:...||...:.:|      .||....|.    ||..:|||||.|.|..|...
Mouse    83 SAFPRWFWGSKAYLTVYDPDYMKVIL------GRSDPKANGAYRLLAPWIGYGLLLLNGQPWFQH 141

  Fly   127 RKHMNPAFKHSVLLSFLPIFNAETDLLVSVFDSFVGQGEKDVLSDLIRWSFAIATQTTLGTDVTK 191
            |:.:.|||.:.:|   .|......|.:..:.|.:....::|...::.:....:...|.:....:.
Mouse   142 RRMLTPAFHYDIL---KPYVKNMADSIRLMLDKWERLADQDSSIEIFQHISLMTLDTVMKCAFSH 203

  Fly   192 DDNFENDAILKTY-------QSMLRLTIINIFVPFVQNKIVSKLFGLEWLRRRDASAINKMINNI 249
            ..:.:.|...:||       .::....:.||   |.||..:.||.....|.::.....:...:.:
Mouse   204 KGSVQVDGNYRTYLQAIGDLNNLFHSRVRNI---FHQNDTIYKLSSNGRLAKQACQLAHDHTDGV 265

  Fly   250 LDKKLNSNPENYCESELKTVIHRA------IELF----RNDEMSLMELGAECSSMVLAAFETSAH 304
            :..:.:...:   |.||:.:..:.      |.||    ..|.||..:|.||..:.:....:|:|.
Mouse   266 IKLRKDQLQD---EGELEKIKKKRRLDFLDILLFARMENGDSMSDKDLRAEVDTFMFEGHDTTAS 327

  Fly   305 TVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTHTDLQQLVYLDRVLNETLRLMPSVPFSSR 369
            .|.:....||..|:||:....|::.  .|..|..:|...|.|:.|....:.|.|||.|.||...|
Mouse   328 GVSWIFYALATHPDHQQRCREEVQS--LLGDGSSITWDHLDQIPYTTMCIKEALRLYPPVPGIVR 390

  Fly   370 ETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQFNPENFLPEKIHDRHPYAFIPFSKG 434
            |....:...:|..:|||:.:::.|:....|...|.:... |:|..|.|:.  .||.::|:|||.|
Mouse   391 ELSTSVTFPDGRSLPKGVQVTLSIYGLHHNPKVWPNPEV-FDPSRFAPDS--PRHSHSFLPFSGG 452

  Fly   435 KRNCIGWRYGLMSSKLALVKILRNYKL 461
            .|||||.::.:...|:.:...|..::|
Mouse   453 ARNCIGKQFAMSELKVIVALTLLRFEL 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 102/417 (24%)
Cyp4a10NP_034141.3 p450 52..503 CDD:278495 102/417 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.