DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and CYP721A1

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_177649.1 Gene:CYP721A1 / 843850 AraportID:AT1G75130 Length:505 Species:Arabidopsis thaliana


Alignment Length:505 Identity:125/505 - (24%)
Similarity:215/505 - (42%) Gaps:67/505 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FAIILCVYFL------------WSRRRFYIMMLKLPGPMGFPFIGLAFEYIRLKRKIRLRTI--- 59
            |.::|..:||            | |.:.:.....:.||....|.|.:.|..||..:.:.:.|   
plant     5 FILVLVFFFLVFRFIYSNIWVPW-RIQSHFKKQSVTGPSYRIFSGNSGEVSRLTAEAKSKPIPSG 68

  Fly    60 ----------------LFKIYGKTVLTWIGLTPVLVTCEPKILEDIFTSPNCSNRSSVVDKAISS 108
                            ..::||||.|.|.|..||:.|.:|:::.:..|:....:|  :....:|.
plant    69 RNPHEFVHRVAPHYHEWSRVYGKTFLYWFGSKPVVATSDPRLIREALTTGGSFDR--IGHNPLSK 131

  Fly   109 CL-GLGLLTLKNNHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGG-DINLLPEL 171
            .| ..||..|:.:.|...|::...:|....:..:||.:......|:....:..:|| :|.|  |:
plant   132 LLYAQGLPGLRGDQWAFHRRIAKQAFTMEKLKRWVPQMVTSTMMLMEKWEDMRNGGEEIEL--EV 194

  Fly   172 NKWSFKIAAQITMGDEVRNQANYQNG--NLLESYKALNNLIPIGVVMPWLR---NKYLGKLFSYE 231
            :|....::|::.......|......|  .|.|....|..|:...|.:|..|   :|...:::..|
plant   195 HKEMHNLSAEMLSRTAFGNSVEEGKGIFELQERMMRLFYLVRWSVYIPGFRFFPSKTNREIWRIE 259

  Fly   232 KRRLEAATQSNAFIKDIIDKKLSSTDNSSE--PALIDRILNLVRIGE---LSYDDVMGEFSNIIF 291
            |       |....|..:|:...::.:.|..  .|.:....|  :.|:   |..::|..|.....|
plant   260 K-------QIRVSILKLIENNKTAVEKSGTLLQAFMSPYTN--QNGQEEKLGIEEVTDECKTFYF 315

  Fly   292 AASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHAD-LEKLVKLDRVLHETMRL 355
            ||.:|.:..:..||:|:||..::|:...||:..|.   |:......| |:.|..|..:::||:||
plant   316 AAKETTANLMTFVLVLLAMNQEWQNIAREEVICVL---GQTGLPTLDILQDLKTLSMIINETLRL 377

  Fly   356 IPAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRARPP 420
            .|....|.|.|....:|.: ..||.|..|.:.:...|.:|:.||..|..|||..|....|::.  
plant   378 YPPAMTLNRDTLKRAKLGD-LDIPAGTQLYLSVVAMHHDKETWGDDAEEFNPRRFEDPKKQSA-- 439

  Fly   421 YSYLPFSKGKKTCLGWKLSLISAKLALAKILRNY--MLSTTFLYKDLRFI 468
             ..:||..|.:||:|..|::..||..||.||:.|  .||.::.:..:.|:
plant   440 -LLVPFGLGPRTCVGQNLAVNEAKTVLATILKYYSFRLSPSYAHAPVLFV 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 117/458 (26%)
CYP721A1NP_177649.1 p450 26..495 CDD:386267 121/484 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.