DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and AT1G73340

DIOPT Version :10

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001319373.1 Gene:AT1G73340 / 843669 AraportID:AT1G73340 Length:487 Species:Arabidopsis thaliana


Alignment Length:74 Identity:19/74 - (25%)
Similarity:30/74 - (40%) Gaps:11/74 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LVDYDTPKDVGQKKLVKAVDRTKTFQEQLFQQDEKVNGERIVSLGGGFSKYHRRKCAVDVGLAEN 211
            :.:|....||..:|.:..:.|.|       |.|..:.|.|  .||..||.....:..:...:..:
plant    63 IYNYFDASDVSTQKYMMEIQRDK-------QLDYLMKGLR--QLGPQFSSLDANRPWLCYWILHS 118

  Fly   212 IA--GYTVE 218
            ||  |.||:
plant   119 IALLGETVD 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 CYP313-like 65..482 CDD:410680 19/74 (26%)
AT1G73340NP_001319373.1 CYP90-like 75..479 CDD:410669 16/62 (26%)

Return to query results.
Submit another query.