DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and CYP72C1

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:252 Identity:55/252 - (21%)
Similarity:105/252 - (41%) Gaps:52/252 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LPGPMGFPFIGLAFEYIRLKRKIRLRTILFKIYGKTVLTWIGLTPVLVTCEPKILEDI------F 90
            ||.|:...|:.....::.       .|:|  .:||...||.|..|.::..:|:.|.:|      |
plant    71 LPLPLDADFLPRMMPFLH-------HTVL--KHGKKCFTWYGPYPNVIVMDPETLREIMSKHELF 126

  Fly    91 TSPNCSNRSSVVDKAISSCLGLGLLTLKNNHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLVTL 155
            ..|...:.:.|.   :|     |||..:...|::.|.:|.|:|:.:.:.|.:|..|:...   .:
plant   127 PKPKIGSHNHVF---LS-----GLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCK---EM 180

  Fly   156 LAEFVDGGDINLLPELNKWSF------KIAAQITMGDEVRNQANYQNGNLLESYKALNNLIPIGV 214
            |.|:..........||:.|:.      .:.|:.:.||      :|::|  ::.::.....|.:|:
plant   181 LEEWERLASAKGTMELDSWTHCHDLTRNMLARASFGD------SYKDG--IKIFEIQQEQIDLGL 237

  Fly   215 VMPWLRNKYL-GKLF---SYEKRRLEAATQSNAFIKDIID------KKLSSTDNSSE 261
            :.  :|..|: |..|   .:.:|..|......|..|.:|:      |:...||.:|:
plant   238 LA--IRAVYIPGSKFLPTKFNRRLRETERDMRAMFKAMIETKEEEIKRGRGTDKNSD 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 54/251 (22%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.