DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and CYP708A2

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_851152.1 Gene:CYP708A2 / 834851 AraportID:AT5G48000 Length:518 Species:Arabidopsis thaliana


Alignment Length:531 Identity:106/531 - (19%)
Similarity:184/531 - (34%) Gaps:155/531 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FLWSRRRFYIMMLKL-------------------PGPMGFPFIGLAFEYIR-----------LKR 52
            |:||...:.|.:..:                   ||.||.|.||...::..           .||
plant    44 FVWSAAVWVIAVAAVVISKWLYRWSNPKCNGKLPPGSMGLPIIGETCDFFEPHGLYEISPFVKKR 108

  Fly    53 KIRLRTILFKIYGKTVLTWIGLTPVLVTCEPKILEDIFTSPNCS-------------NRSSV--- 101
            .::        ||....|.|..:..:|..||.|:.::|...|.|             .:.:|   
plant   109 MLK--------YGPLFRTNIFGSNTVVLTEPDIIFEVFRQENKSFVFSYPEAFVKPFGKENVFLK 165

  Fly   102 ---VDKAIS--SCLGLGLLTLKNNHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVD 161
               :.|.:.  |...||...||.....|..::.....::.|         |:.:|......|.|.
plant   166 HGNIHKHVKQISLQHLGSEALKKKMIGEIDRVTYEHLRSKA---------NQGSFDAKEAVESVI 221

  Fly   162 GGDI------NLLPELNKWSFKIAAQITMGDEVRNQANYQNGNLLESYKALNNLIPIGVVMPWLR 220
            ...:      ||.||         .|.|:.|.:....:    ...:|...|..||.|        
plant   222 MAHLTPKIISNLKPE---------TQATLVDNIMALGS----EWFQSPLKLTTLISI-------- 265

  Fly   221 NKYLGKLFSYEKRRLEAATQSNAFIKDIIDKKLSSTDNSSEPALIDRILNLVRIGELSYDDVMGE 285
              |  |:|...:..|:.       |||:..::.:|.:...     |.:..:|..|| ..|.:..|
plant   266 --Y--KVFIARRYALQV-------IKDVFTRRKASREMCG-----DFLDTMVEEGE-KEDVIFNE 313

  Fly   286 FS--NIIFAASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADL--------- 339
            .|  |:|||.......:.::|..|...|          |||...:..|.:..||.:         
plant   314 ESAINLIFAILVVAKESTSSVTSLAIKF----------LAENHKALAELKREHAAILQNRNGKGA 368

  Fly   340 --------EKLVKLDRVLHETMRLIPAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKD 396
                    .::...:.|::||:|:....|::.|:..:.::: .|:.||.|..:.:.....|.|..
plant   369 GVSWEEYRHQMTFTNMVINETLRMANMAPIMYRKAVNDVEI-KGYTIPAGWIVAVIPPAVHFNDA 432

  Fly   397 IWGPQANAFNPDNFLP---ENKRARP-PYSYLPFSKGKKTCLGWKLSLISAKLALAKILRNYMLS 457
            |:.      ||..|.|   |.|..|. ..:::.|..|.:.|:|.:.:.:...:.:..::..|..|
plant   433 IYE------NPLEFNPWRWEGKELRSGSKTFMVFGGGVRQCVGAEFARLQISIFIHHLVTTYDFS 491

  Fly   458 TTFLYKDLRFI 468
               |.::..||
plant   492 ---LAQESEFI 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 98/485 (20%)
CYP708A2NP_851152.1 p450 64..516 CDD:299894 102/511 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.