DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and CYP72A13

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_188084.1 Gene:CYP72A13 / 820694 AraportID:AT3G14660 Length:512 Species:Arabidopsis thaliana


Alignment Length:520 Identity:118/520 - (22%)
Similarity:231/520 - (44%) Gaps:67/520 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AIILCVYFLW-SRRRFYI------MMLKLPGPMGFPFIGLAFEY--------------IRLKRKI 54
            |:::..:::| :.:|.::      ..|:..|..|.|:..|..:.              |.|...|
plant    13 AVVVVSWWVWRTLQRVWLKPKMLESYLRRQGLAGTPYTPLVGDLKRNFSMLAEARSKPINLTDDI 77

  Fly    55 RLRTI-----LFKIYGKTVLTWIGLTPVLVTCEPKILEDIFTSPNCSNRSSVVDKAISSCLG--- 111
            ..|.:     :.|.:|:|..||.|..|.:...:|:.::::|      |:.....||.:..||   
plant    78 TPRIVPYPLQMLKTHGRTFFTWFGPIPTITIMDPEQIKEVF------NKVYDFQKAHTFPLGRLI 136

  Fly   112 -LGLLTLKNNHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLV----TLLAEFVDGGDINLLPEL 171
             .||::...:.|.:.|:::.|:|....:.:.||..:...:.:|    .|:.:.....::::.|.|
plant   137 AAGLVSYDGDKWTKHRRIINPAFHLEKIKNMVPAFHQSCSEIVGEWDKLVTDKQSSCEVDIWPWL 201

  Fly   172 NKWSFKIAAQITMGDEVRNQANYQNG-NLLESYKALNNLIPIG---VVMPWLRNKYLGKLFSYEK 232
            ...:..:.::...|      ::|:.| .:.|....|..||...   .::|..|  |..   :...
plant   202 VSMTADVISRTAFG------SSYKEGQRIFELQAELAQLIIQAFRKAIIPGYR--YFP---TKGN 255

  Fly   233 RRLEAATQSNAFI-KDIIDKKLSSTDNSSEPA------LIDRILNLVRIGELSYDDVMGEFSNII 290
            ||::||.:...|| :.|::|:|.:.:....|:      |::..|...:...:|.:::|.|.....
plant   256 RRMKAAAREIKFILRGIVNKRLRAREAGEAPSDDLLGILLESNLGQTKGNGMSTEELMEECKLFY 320

  Fly   291 FAASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVKLDRVLHETMRL 355
            ||..:|.::.:...::|::....:|....||:.:||   |:.|.....|.:|..:..:|:|.:||
plant   321 FAGQETTTVLLVWTMVLLSQHQDWQARAREEVKQVF---GDKEPDAEGLNQLKVMTMILYEVLRL 382

  Fly   356 IPAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPE-NKRARP 419
            .|.|..|.|.....:||.: ..:|.||.:.:.|....|::::||..|..|.||.|... :|..:.
plant   383 YPPVVQLTRAIHKEMQLGD-LTLPGGVQISLPILLIQRDRELWGNDAGEFKPDRFKDGLSKATKN 446

  Fly   420 PYSYLPFSKGKKTCLGWKLSLISAKLALAKILRNYMLSTTFLYKDLRFIDNTTMKLAEQPLLAVK 484
            ..|:.||:.|.:.|:|...:|:.||:|:..|||.:....:..|....:...||......||:..|
plant   447 QVSFFPFAWGPRICIGQNFALLEAKMAMTLILRKFSFELSPSYVHAPYTVLTTHPQFGAPLILHK 511

  Fly   485  484
            plant   512  511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 108/463 (23%)
CYP72A13NP_188084.1 p450 24..512 CDD:299894 116/509 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.