DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and CYP72A7

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_188079.1 Gene:CYP72A7 / 820689 AraportID:AT3G14610 Length:512 Species:Arabidopsis thaliana


Alignment Length:515 Identity:111/515 - (21%)
Similarity:220/515 - (42%) Gaps:78/515 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LTLQIFEAFAIILCVYFLWSRR---------RFYIMMLKLPGPMGFPFIGLAFEYIRLKRKI--- 54
            ::..:..|..:::.|..||:.|         :.....||..|..|.|:..|..:   :||.:   
plant     1 MSFSVVAALPVLVAVVVLWTWRIVKWVWIKPKMLESSLKRQGLTGTPYTPLVGD---IKRNVDMM 62

  Fly    55 ----------------RLRTILFKI---YGKTVLTWIGLTPVLVTCEPKILEDIFTSPNCSNRSS 100
                            ||..:..|:   :|||...|||..|.:|...|:.::::|...|...::|
plant    63 MEARSKPINVTDDITPRLLPLALKMLNSHGKTFFIWIGPLPTIVITNPEQIKEVFNKVNDFEKAS 127

  Fly   101 VVDKAISSCLGLGLLTLKNNHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLV----TLLAEFVD 161
            ..  .:...|..||.:.|.:.|...|:::.|:|....:.:.:|...:..:.:|    .|..:...
plant   128 TF--PLIRLLAGGLASYKGDKWASHRRIINPAFHLEKIKNMIPAFYHCCSEVVCQWEKLFTDKES 190

  Fly   162 GGDINLLPELNKWSFKIAAQITMGDEVR-NQANYQ-NGNLLESYKALNNLIPIGVVMPWLRNKYL 224
            ..::::.|.|...:..:.:....|...: .|..:| .|.|.|            ::....:..|:
plant   191 PLEVDVWPWLVNMTADVISHTAFGSSYKEGQRIFQLQGELAE------------LIAQAFKKSYI 243

  Fly   225 -GKLF--SYEKRRLEAATQS-NAFIKDIIDKKLSSTDNSSEPALIDRILNLVRIGE-------LS 278
             |..|  :...||::|..:. :..::.|:.|:..:.: :.|||..|.:..|:....       :|
plant   244 PGSRFYPTKSNRRMKAIDREVDVILRGIVSKREKARE-AGEPANDDLLGILLESNSEESQGNGMS 307

  Fly   279 YDDVMGEFSNIIFAASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLV 343
            .:|||.|.....||..:|.|:.:...::|::....:|....||:.:|..     |.:..|:|.|.
plant   308 VEDVMKECKLFYFAGQETTSVLLVWTMVLLSHHQDWQARAREEVMQVLG-----ENNKPDMESLN 367

  Fly   344 KL---DRVLHETMRLIPAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAF 405
            .|   ..:.:|.:||.|.|..|.|..:..::|.. ..:|.|:.:.:......|:.::||..|..|
plant   368 NLKVMTMIFNEVLRLYPPVAQLKRVVNKEMKLGE-LTLPAGIQIYLPTILVQRDTELWGDDAADF 431

  Fly   406 NPDNFLPE-NKRARPPYSYLPFSKGKKTCLGWKLSLISAKLALAKILR--NYMLSTTFLY 462
            .|:.|... :|..:...|:.||..|.:.|:|...:::.||:|:|.||:  ::.||.::::
plant   432 KPERFRDGLSKATKNQVSFFPFGWGPRICIGQNFAMLEAKMAMALILQKFSFELSPSYVH 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 103/469 (22%)
CYP72A7NP_188079.1 p450 21..512 CDD:299894 107/495 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.