DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and Cyp4f18

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_077764.2 Gene:Cyp4f18 / 72054 MGIID:1919304 Length:524 Species:Mus musculus


Alignment Length:432 Identity:102/432 - (23%)
Similarity:172/432 - (39%) Gaps:81/432 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 WIG-LTPVLVTCEPKILEDIFTSPN-CSNRSSVVDKAISSCLGLGLLTLKNNHWNERRKLLLPSF 133
            |:| |.||:....|..::.:..:|. .:.:.:|..:.:...||.|||....:.|:..|::|.|:|
Mouse    91 WVGPLHPVIRIFHPAFIKPVVLAPALVAPKDTVFYRFLKPWLGDGLLMSTGDKWSRHRRMLTPAF 155

  Fly   134 KNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINL----------LPELNKWSFKIAAQITMGDEV 188
            ..|.:..:|.|.|:..|.:..........|...|          |..|.|..|..          
Mouse   156 HFNILKPYVKVFNDSTNIMHAKWQRLASKGSAYLNMFEHISLMTLDSLQKCVFSF---------- 210

  Fly   189 RNQANYQNGNLLESYKALNNLIPIGVVMPWLRNKYL--GKLFSY--------------------- 230
              .:|.|.    :..:.:..::.:..::.....:.|  ..||.|                     
Mouse   211 --DSNCQE----KPSEYITAILELSTLVARRHQRLLLHVDLFYYLTHDGMRFRKACRLVHDFTDA 269

  Fly   231 ---EKRR----------LEAATQSNAFIKDIIDKKLSSTDNSSEPALIDRILNLVRIGELSYDDV 282
               |:||          |:|..::...  |.||..|.|.|...:              .||.:|:
Mouse   270 VIRERRRTLLDQGGVDVLKAKAKAKTL--DFIDVLLLSKDEHGK--------------ALSDEDI 318

  Fly   283 MGEFSNIIFAASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVKLDR 347
            ..|....:|...||.:..::.:|..:|..|:||:...:|:.|:.......|....||.:|..|..
Mouse   319 RAEADTFMFGGHDTTASGLSWILYNLARHPEYQERCRQEVRELLRDREPEEIEWDDLAQLPFLTM 383

  Fly   348 VLHETMRLIPAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLP 412
            .:.|::||.|.|..:.|..:..|.|.:|..||:||...|.||.||.|..:| |....::|..|..
Mouse   384 CIKESLRLHPPVTAISRCCTQDIVLPDGRVIPKGVISRISIFGTHHNPAVW-PDPEVYDPFRFDA 447

  Fly   413 ENKRARPPYSYLPFSKGKKTCLGWKLSLISAKLALAKILRNY 454
            :|.:.|.|.:::|||.|.:.|:|...::...|:|||..|..:
Mouse   448 DNVKGRSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRF 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 102/432 (24%)
Cyp4f18NP_077764.2 p450 52..516 CDD:365848 102/432 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.