DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and CYP4F12

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_076433.3 Gene:CYP4F12 / 66002 HGNCID:18857 Length:524 Species:Homo sapiens


Alignment Length:460 Identity:112/460 - (24%)
Similarity:183/460 - (39%) Gaps:98/460 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YGKTVLTWIG-LTPVLVTCEPKILEDIF-TSPNCSNRSSVVDKAISSCLGLGLLTLKNNHWNERR 126
            |.:....|:| :.|.:|.|.|..:..|. .|...:.:.::..:.:...||.|:|....:.|:..|
Human    84 YSQGFTVWLGPIIPFIVLCHPDTIRSITNASAAIAPKDNLFIRFLKPWLGEGILLSGGDKWSRHR 148

  Fly   127 KLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINL----------LPELNKWSFK---- 177
            ::|.|:|..|.:.|::.:.|..||.::.........|...|          |..|.|..|.    
Human   149 RMLTPAFHFNILKSYITIFNKSANIMLDKWQHLASEGSSRLDMFEHISLMTLDSLQKCIFSFDSH 213

  Fly   178 --------IAAQITMGD--EVRNQANYQNGNLLESYKALNNLIPIGVVMPWLRNKYL---GKLFS 229
                    ||..:.:..  |.|:|...|:.:.|                     .||   |:.|.
Human   214 CQERPSEYIATILELSALVEKRSQHILQHMDFL---------------------YYLSHDGRRFH 257

  Fly   230 -------------YEKRRLEAATQS-NAFIK--------DIIDKKLSSTDNSSEPALIDRILNLV 272
                         ..:||....||. :.|.|        |.||..|.|.|...:           
Human   258 RACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDVLLLSKDEDGK----------- 311

  Fly   273 RIGELSYDDVMGEFSNIIFAASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHA 337
               .||.:|:..|....:|...||.:..::.||..:|..|:||:...:|:.|:.......|....
Human   312 ---ALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDRDPKEIEWD 373

  Fly   338 DLEKLVKLDRVLHETMRLIPAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQA 402
            ||.:|..|...:.|::||.|..|.:.|..:..|.|.:|..||:|:|.:|||...|.|..:| |..
Human   374 DLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITCLIDIIGVHHNPTVW-PDP 437

  Fly   403 NAFNPDNFLPENKRARPPYSYLPFSKGKKTCLGWKLSLISAKLALAKILRNYMLSTTFLYKDLRF 467
            ..::|..|.|||.:.|.|.:::|||.|.:.|:|...::...|:.||.:|.::           ||
Human   438 EVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHF-----------RF 491

  Fly   468 IDNTT 472
            :.:.|
Human   492 LPDHT 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 109/444 (25%)
CYP4F12NP_076433.3 p450 52..506 CDD:306555 112/460 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.