DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and CYP4F11

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001122404.1 Gene:CYP4F11 / 57834 HGNCID:13265 Length:524 Species:Homo sapiens


Alignment Length:445 Identity:118/445 - (26%)
Similarity:189/445 - (42%) Gaps:71/445 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TILFKIYGKTVLTWIGLT-PVLVTCEPKILEDIFTSPNCSNRSSVVDK------AISSCLGLGLL 115
            |.|...|.:....|:|.| |:|:.|.|.|:.     |..|..::|..|      .:...||.|||
Human    78 TQLVTTYPQGFKLWLGPTFPLLILCHPDIIR-----PITSASAAVAPKDMIFYGFLKPWLGDGLL 137

  Fly   116 TLKNNHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINL----------LPE 170
            ....:.|:..|::|.|:|..|.:..::.:.|...|.:..........|...|          |..
Human   138 LSGGDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQRLASEGSARLDMFEHISLMTLDS 202

  Fly   171 LNK--WSFK----------IAA--QITMGDEVRNQANYQNGNLLESYKALNNLIPIGVVMPWLRN 221
            |.|  :||:          |||  :::...|.|||      .:|.....|..|.|.|  ..:.|.
Human   203 LQKCVFSFESNCQEKPSEYIAAILELSAFVEKRNQ------QILLHTDFLYYLTPDG--QRFRRA 259

  Fly   222 KYLGKLFS---YEKRRLEAATQS-NAFIK--------DIIDKKLSSTDNSSEPALIDRILNLVRI 274
            .:|...|:   .::||....||. :.|:|        |.||..|.|.|...:             
Human   260 CHLVHDFTDAVIQERRCTLPTQGIDDFLKNKAKSKTLDFIDVLLLSKDEDGK------------- 311

  Fly   275 GELSYDDVMGEFSNIIFAASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADL 339
             |||.:|:..|....:|...||.:..::.||..:|..|:||:...:|:.|:.......|....||
Human   312 -ELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQELLKDREPIEIEWDDL 375

  Fly   340 EKLVKLDRVLHETMRLIPAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANA 404
            .:|..|...:.|::||.|.||::.|..:....|.:|..||:|:..:|:|...|.|..:| |....
Human   376 AQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGRVIPKGIVCLINIIGIHYNPTVW-PDPEV 439

  Fly   405 FNPDNFLPENKRARPPYSYLPFSKGKKTCLGWKLSLISAKLALAKILRNYMLSTT 459
            ::|..|..||.:.|.|.:::|||.|.:.|:|...::...|:.||..|.::.:..|
Human   440 YDPFRFDQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFRILPT 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 117/442 (26%)
CYP4F11NP_001122404.1 p450 52..506 CDD:365848 118/445 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.