DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and Cyp4f1

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_062569.2 Gene:Cyp4f1 / 56266 RGDID:70926 Length:524 Species:Rattus norvegicus


Alignment Length:440 Identity:117/440 - (26%)
Similarity:184/440 - (41%) Gaps:67/440 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TILFKIYGKTVLTWIG-LTPVLVTCEPKILEDIFTSPNCSNRSSVVD----KAISSCLGLGLLTL 117
            |.|...|.:..|.||| :.||:..|...|:..|.   |.|...::.|    ..:...||.|||..
  Rat    78 TRLVGTYPQGFLMWIGPMVPVITLCHSDIVRSIL---NASAAVALKDVIFYTILKPWLGDGLLVS 139

  Fly   118 KNNHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINL----------LPELN 172
            ..:.|:..|::|.|:|..|.:..:|.:.|:..|.:.......:..|...|          |..|.
  Rat   140 AGDKWSRHRRMLTPAFHFNILKPYVKIFNDSTNIMHAKWKRLISEGSSRLDMFEHVSLMTLDSLQ 204

  Fly   173 KWSFK------------IAAQITMGDEVRNQANYQNGNLLESYKALNNLIPIGVVMPWLRNKYLG 225
            |..|.            |||.:.:...|..:  :|...|.  ...|.||.|.|:..    :|...
  Rat   205 KCVFSFDSNCQEKSSEYIAAILELSALVAKR--HQQPLLF--MDLLYNLTPDGMRF----HKACN 261

  Fly   226 KLFSY------EKRR------LEAATQSNAFIK--DIIDKKLSSTDNSSEPALIDRILNLVRIGE 276
            .:..:      |:||      |:...:|.|..|  |.||..|.:.|...:              |
  Rat   262 LVHEFTDAVIRERRRTLPDQGLDEFLKSKAKSKTLDFIDVLLLTKDEDGK--------------E 312

  Fly   277 LSYDDVMGEFSNIIFAASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEK 341
            ||.:|:..|....:|...||.:..::.:|..:|..|:||:...:|:.|:.......|....||.:
  Rat   313 LSDEDIRAEADTFMFEGHDTTASGLSWILYNLAKHPEYQERCRQEVQELLRDRDPEEIEWDDLAQ 377

  Fly   342 LVKLDRVLHETMRLIPAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFN 406
            |..|...:.|::||.|.|.::.|..:..|.|.:|..||:|:..:|.||..|.|..:| |....:|
  Rat   378 LPFLTMCIKESLRLHPPVTVISRCCTQDILLPDGRTIPKGIICLISIFGIHHNPSVW-PDPEVYN 441

  Fly   407 PDNFLPENKRARPPYSYLPFSKGKKTCLGWKLSLISAKLALAKILRNYML 456
            |..|.|||.:...|.:::|||.|.:.|:|...::...|:|||..|..:.|
  Rat   442 PFRFDPENIKDSSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRL 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 117/440 (27%)
Cyp4f1NP_062569.2 CYP4F 74..515 CDD:410772 117/440 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.