DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and Cyp4f17

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001178915.1 Gene:Cyp4f17 / 500801 RGDID:1561655 Length:524 Species:Rattus norvegicus


Alignment Length:435 Identity:106/435 - (24%)
Similarity:176/435 - (40%) Gaps:79/435 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LTWIGL-TPVLVTCEPKILEDIFTSPNCSNRSSVVDKA------ISSCLGLGLLTLKNNHWNERR 126
            |.|||: .|:|....||.:..|..:|     ::|..|.      :...||.|||......|:.:|
  Rat    89 LCWIGIFYPILRLIHPKFIGPILQAP-----AAVAPKEMIFYGFLKPWLGDGLLVSAGEKWSRQR 148

  Fly   127 KLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINL----------LPELNKWSFKIAAQ 181
            :||.|:|..:.:..:|...|...|.:..........|...|          |..|.|..|..   
  Rat   149 RLLTPAFHFDILKPYVKNFNKSVNIMHAKWQRLTAKGSARLDMFEHISLMTLDSLQKCVFSF--- 210

  Fly   182 ITMGDEVRNQANYQN--GNLLESYKALNNLIPIGVVMPWLRNKYL------GKLFS--------- 229
                     .:|.|.  ...:.:.:.|::||......|:|...:|      |:.|.         
  Rat   211 ---------DSNCQESPSEYIAAIQELSSLIVKRHHQPFLYMDFLYYLTADGRRFRKACDLVHNF 266

  Fly   230 -----YEKRRLEAATQSNAFIK--------DIIDKKLSSTDNSSEPALIDRILNLVRIGELSYDD 281
                 .|:||..::...:.|:|        |.||..|.:.|...:              |||.:|
  Rat   267 TDAVIRERRRTLSSQSVDEFLKSKTKSKTLDFIDVLLLAKDEHGK--------------ELSDED 317

  Fly   282 VMGEFSNIIFAASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVKLD 346
            :..|....:|...||.:..::.:|..:|..|::|:...:|:.|:.......|....||.:|..|.
  Rat   318 IRAEADTFMFGGHDTTASALSWILYNLARHPEHQERCRQEVRELLRDREPEEIEWDDLTQLPFLT 382

  Fly   347 RVLHETMRLIPAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFL 411
            ..:.|::||.|.|.::.|..:..:.|.:|..||:|...:|.||..|.|..:| |....::|..|.
  Rat   383 MCIKESLRLHPPVTVISRCCTQDVVLPDGRVIPKGNDCIISIFGVHHNPSVW-PDPEVYDPFRFD 446

  Fly   412 PENKRARPPYSYLPFSKGKKTCLGWKLSLISAKLALAKILRNYML 456
            .||.:.|.|.:::|||.|.:.|:|...::...|:|:|..|..:.|
  Rat   447 SENPQKRSPLAFIPFSAGPRNCIGQTFAMNEMKVAVALTLLRFRL 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 106/435 (24%)
Cyp4f17NP_001178915.1 p450 52..514 CDD:278495 106/435 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.