DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and dib

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_524810.2 Gene:dib / 45282 FlyBaseID:FBgn0000449 Length:489 Species:Drosophila melanogaster


Alignment Length:476 Identity:104/476 - (21%)
Similarity:195/476 - (40%) Gaps:93/476 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LPGPMG----------FPFIGLAFEYIRLKRKIRLRTILFKIYGKTV---------LTWIGLTPV 77
            :|||.|          .|.|| ::.::||.:..:.:   ::.||..|         :.|:     
  Fly    24 IPGPRGPFGMGNLYNYLPGIG-SYSWLRLHQAGQDK---YEKYGAIVRETIVPGQDIVWL----- 79

  Fly    78 LVTCEPKILEDIFTSPNCSNRSSVVDKA--------ISSCLGLGLLTLKNNHWNERRKLLLPSFK 134
               .:||.:..:....:|..|.|.:..|        :....|| |.|.....|..|.::......
  Fly    80 ---YDPKDIALLLNERDCPQRRSHLALAQYRKSRPDVYKTTGL-LPTNGPEWWRIRAQVQKELSA 140

  Fly   135 NNAVLSFVPVLNNEANFLVTLLAEFVDGGDINLLPELNKWSFKIAAQITMGDEVRN------QAN 193
            ..:|.:||..::......:..|.|..:||.|::||:|.:.:.::...:|.|..:::      ...
  Fly   141 PKSVRNFVRQVDGVTKEFIRFLQESRNGGAIDMLPKLTRLNLELTCLLTFGARLQSFTAQEQDPR 205

  Fly   194 YQNGNLLESYKALNNLIPIGVVMPWLRNKYLGKLFSYEKRRLEAATQSNAFIKDIIDKKLSSTDN 258
            .::..|:::.:..|:.|     :|                 .:...|...|::....:|||...:
  Fly   206 SRSTRLMDAAETTNSCI-----LP-----------------TDQGLQLWRFLETPSFRKLSQAQS 248

  Fly   259 SSEPALIDRILNLVRIG--------------ELSYDDVMGEFSNIIFAASDTLSITVNNVLILMA 309
            ..|...::.:...||.|              ||...||:|..::::.|..||.|.....:|..:|
  Fly   249 YMESVALELVEENVRNGSVGSSLISAYVKNPELDRSDVVGTAADLLLAGIDTTSYASAFLLYHIA 313

  Fly   310 MFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVKLDR-VLHETMRLIP---AVPLLIRQTSHSI 370
            ..|:.|..:.||...|.||..: |.|...|...:...| ||.|::||.|   .|..::.|.:   
  Fly   314 RNPEVQQKLHEEARRVLPSAKD-ELSMDALRTDITYTRAVLKESLRLNPIAVGVGRILNQDA--- 374

  Fly   371 QLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRARPPYSYLPFSKGKKTCLG 435
             :.:|:::|:|.|::.......|.:..:..... |.||.:| :::.|..||..|||..|.:.|:.
  Fly   375 -IFSGYFVPKGTTVVTQNMVACRLEQHFQDPLR-FQPDRWL-QHRSALNPYLVLPFGHGMRACIA 436

  Fly   436 WKLSLISAKLALAKILRNYML 456
            .:|:..:..:.|.::||.|.|
  Fly   437 RRLAEQNMHILLLRLLREYEL 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 104/475 (22%)
dibNP_524810.2 p450 25..446 CDD:299894 99/462 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.