DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and Cyp4ac3

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster


Alignment Length:491 Identity:118/491 - (24%)
Similarity:222/491 - (45%) Gaps:62/491 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IRLKRKIR------LRTILFKIYGKT----VLTWIGLTPV----------------------LVT 80
            :.|.:::|      |.:.:|.:.|||    .|..:.|||.                      |..
  Fly    29 LSLCKRVRTADGSPLESKVFVVPGKTRFGNNLDLLNLTPANIFSYIRESTAKANGQNYIWNFLFA 93

  Fly    81 CEPKIL-----EDIFTSPNCSNRSSVVDKAISSCLGLGLLTLKNNHWNERRKLLLPSFKNNAVLS 140
            .|..|:     |:||.|...:.::...: .|...||.|||...:..|:.|||.|.|:|..|.:.|
  Fly    94 PEYNIVRAEDAEEIFQSTKITTKNMSYE-LIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQS 157

  Fly   141 FVPVLNNEANFLVTLLAEFVDGGDINLLPELNKWSFKIAAQITMGDEVRNQANYQNGNLLESYKA 205
            |:.:...|:...:.:|.:.| |.::.|...:.:::.....:..:|.::.:.:   .||  |..||
  Fly   158 FLSIFKEESKKFIKILDKNV-GFELELNQIIPQFTLNNICETALGVKLDDMS---EGN--EYRKA 216

  Fly   206 LNNLIPI---GVVMPWLRNKYLGKLFSYEKRRLEAATQSNAFIKDIIDKK--------LSSTDNS 259
            :::...:   .:..|.:...:...||...|:........:.|...||.:|        |...|..
  Fly   217 IHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEF 281

  Fly   260 SEP---ALIDRILNLVRIGELSYDDVMGEFSNIIFAASDTLSITVNNVLILMAMFPKYQDNVFEE 321
            .:.   |::|.:|.....|::.:..:..|.:..:|...||.|.::...|:|:|:....|:..:||
  Fly   282 GKKQRYAMLDTLLAAEAEGKIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEE 346

  Fly   322 LAEVFPSGGEFEASHADLEKLVKLDRVLHETMRLIPAVPLLIRQTSHSIQLSNGFYIPEGVTLMI 386
            |.:: |...: |.|.....:|:.|:.|:.|::||.|:.| :|.:|.....:.||..:|:...:.|
  Fly   347 LQDL-PEDID-EVSMFQFNELIHLECVIKESLRLFPSAP-IIGRTCIEESVMNGLVLPKNAQISI 408

  Fly   387 DIFHTHRNKDIWGPQANAFNPDNFLPENKRARPPYSYLPFSKGKKTCLGWKLSLISAKLALAKIL 451
            .|:...|:...: |:.|.|.|:.|||||...|.|::::|||.|.:.|:|.|..::..|:.||.::
  Fly   409 HIYDIMRDARHF-PKPNQFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVI 472

  Fly   452 RNYMLSTTFLYKDLRFIDNTTMKLAEQPLLAVKRRI 487
            ||:.|......:||.|.:...::..:...:..:.|:
  Fly   473 RNFKLLPATQLEDLTFENGIVLRTQQNIKVKFEARV 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 114/460 (25%)
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 113/463 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I1949
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.