DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and Cyp4ac1

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_608916.1 Gene:Cyp4ac1 / 33754 FlyBaseID:FBgn0031693 Length:509 Species:Drosophila melanogaster


Alignment Length:440 Identity:108/440 - (24%)
Similarity:208/440 - (47%) Gaps:25/440 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KIYGKTVLTWIGLTPVLVTCEPKILEDIFTSPNCSNRSSVVDKAISSCLGLGLLTLKNNHWNERR 126
            |..|:..|.:....|:.....|:..|::|.|.....: :||.:.|...||.|||...::.|:.||
  Fly    80 KAKGQNYLWYFLYAPMYNVVRPEEAEEVFQSTKLITK-NVVYELIRPFLGDGLLISTDHKWHSRR 143

  Fly   127 KLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINLLPELNKWSFKIAAQITMG---DEV 188
            |.|.|:|..|.:.||:.:...|....:.:|.:.:| .::.|...:..::.....:..:|   |::
  Fly   144 KALTPAFHFNVLQSFLGIFKEECKKFLNVLEKNLD-AELELNQVIPPFTLNNICETALGVKLDDM 207

  Fly   189 RNQANYQNGNLLESYKALNNLIPIGVVMPWLRNKYLGKLFSYEKRRLEAATQSNAFIKDIIDKK- 252
            .....|:     ::..|:..::...|..|.:...:...::...::.|:.....:.|...||::| 
  Fly   208 SEGNEYR-----KAIHAIEEVLIQRVCNPLMYYNWYFFVYGDYRKHLQNLRIVHDFSSRIIERKR 267

  Fly   253 -------LSSTD---NSSEPALIDRILNLVRIGELSYDDVMGEFSNIIFAASDTLSITVNNVLIL 307
                   |...|   .....|::|.:|.....|::.:..:..|.:..:|...||.|..:...|::
  Fly   268 QQFQQKQLGEVDEFGRKQRYAMLDTLLAAEADGQIDHQGICDEVNTFMFEGYDTTSTCLIFTLLM 332

  Fly   308 MAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVKLDRVLHETMRLIPAVPLLIRQTSHSIQL 372
            :|:....|...:||: |..|...: :.|.....|||.|:.|:.|::|:.|:||.:.||.... .:
  Fly   333 LALHEDVQKKCYEEV-ENLPEDSD-DISMFQFNKLVYLECVIKESLRMFPSVPFIGRQCVEE-TV 394

  Fly   373 SNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRARPPYSYLPFSKGKKTCLGWK 437
            .||..:|:...:.|.|:...|:...: |:.:.|.||.|||||...|.|::|:|||.|::.|:|.|
  Fly   395 VNGMVMPKDTQISIHIYDIMRDPRHF-PKPDLFQPDRFLPENTVNRHPFAYVPFSAGQRNCIGQK 458

  Fly   438 LSLISAKLALAKILRNYMLSTTFLYKDLRFIDNTTMKLAEQPLLAVKRRI 487
            .:::..|:.||.::||:.|......:||.|.:...::..|...:.:.:|:
  Fly   459 FAILEMKVLLAAVIRNFKLLPATQLEDLTFENGIVLRTQENIKVKLSKRV 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 103/409 (25%)
Cyp4ac1NP_608916.1 p450 86..504 CDD:278495 105/428 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I1949
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.