DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and Cyp4f39

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_796281.1 Gene:Cyp4f39 / 320997 MGIID:2445210 Length:532 Species:Mus musculus


Alignment Length:540 Identity:120/540 - (22%)
Similarity:219/540 - (40%) Gaps:106/540 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTLQIFEAFAIILCVYFLWSRRRFYIMMLKL---PGPMGFPF-IGLAFEYIRLKRKIRLRTILF 61
            :|.|.:|..|.:::..:.|:|  .|.|...||   |.|.|..: :|....|:..::.::....:.
Mouse    27 LLLLVLFFFFRLLVRAFKLFS--DFRITCRKLSCFPEPPGRHWLLGHMSMYLPNEKGLQNEKKVL 89

  Fly    62 KIYGKTVLTWIG-LTPVLVTCEPKILEDIF-TSPNCSNRSSVVDKAISSCLGLGLLTLKNNHWNE 124
            ......:|.|:| ..|:||...|..::.:. .|...:.:.......:...||.|||..|.|.|:.
Mouse    90 DTMHHIILAWVGPFLPLLVLVHPDYIKPVLGASAAIAPKDEFFYSFLKPWLGDGLLISKGNKWSR 154

  Fly   125 RRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDIN-----------LLPELNK--WSF 176
            .|:||.|:|..:.:..::.:.|...|.:.......:..|.:.           .|..|.|  :|:
Mouse   155 HRRLLTPAFHFDILKPYMKIFNQCTNIMHAKWRRHLAEGSVTSFDMFEHISLMTLDSLQKCVFSY 219

  Fly   177 KIAAQITMGDEVRNQANYQNGNLLESYKALNNLIPIGVVMPWLRNKYLGKLFSY----------- 230
            ....|..|.|.:                  :::|.:..::  :|.:|  :|..|           
Mouse   220 NSDCQERMSDYI------------------SSIIELSALV--VRRQY--RLHHYLDFMYYLTADG 262

  Fly   231 -------------------EKRRLEAATQSNAFIK-------DIIDKKLSSTDNSSEPALIDRIL 269
                               |:|:......:.|::|       |.||..|.:.|...:        
Mouse   263 RRFRQACDTVHNFTTEVIQERRQALRQQGAEAWLKAKQGKTLDFIDVLLLAKDEEGK-------- 319

  Fly   270 NLVRIGELSYDDVMGEFSNIIFAASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEA 334
                  |||.:|:..|....:|...||.|..::..|..:|.:|:||:...||:.||.......|.
Mouse   320 ------ELSDEDIRAEADTFMFEGHDTTSSGLSWALFNLAKYPEYQEKCREEIQEVMKGRELEEL 378

  Fly   335 SHADLEKLVKLDRVLHETMRLIPAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWG 399
            ...||.:|......:.|::|..|.|.|:.|:.:..|:|.:|..||:|:..::.|:.||.|..:| 
Mouse   379 DWDDLTQLPFTTMCIKESLRQFPPVTLISRRCTEDIKLPDGRVIPKGIICLVSIYGTHHNPIVW- 442

  Fly   400 PQANAFNPDNFLPENKRARPPYSYLPFSKGKKTCLGWKLSLISAKLALAKILRNYMLSTTFLYKD 464
            |.:..:||..|.|:..:.|.|.:::|||.|.:.|:|...::...::.:|..|..:.||.      
Mouse   443 PDSKVYNPYRFDPDTPQQRSPLAFVPFSAGPRNCIGQSFAMAEMRVVVALTLLRFRLSV------ 501

  Fly   465 LRFIDNTTMKLAEQPLLAVK 484
                 :.|.|:..:|.|.::
Mouse   502 -----DRTHKVRRKPELILR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 105/477 (22%)
Cyp4f39NP_796281.1 p450 60..515 CDD:365848 110/502 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.