DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and Cyp4f18

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001028858.2 Gene:Cyp4f18 / 290623 RGDID:1305261 Length:524 Species:Rattus norvegicus


Alignment Length:419 Identity:106/419 - (25%)
Similarity:172/419 - (41%) Gaps:55/419 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 WIG-LTPVLVTCEPKILEDIFTSP-NCSNRSSVVDKAISSCLGLGLLTLKNNHWNERRKLLLPSF 133
            |:| ..||:....|..::.:..:| :.:.:..|..:.:...||.|||....:.|:..|.:|.|:|
  Rat    91 WVGPWHPVIRIFHPAFIKPVILAPASVAPKDRVFYRFLKPWLGDGLLLSTGDKWSRHRHMLTPAF 155

  Fly   134 KNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINL----------LPELNKWSF--------KIAA 180
            ..|.:..:|.:.|:..|.:..........|...|          |..|.|..|        |.:.
  Rat   156 HFNILKPYVKIFNDSTNIMHAKWQRLASQGSARLDMFEHISLMTLDSLQKCVFSFDSNCQEKPSE 220

  Fly   181 QITMGDEVRNQANYQNGNLLESYKALNNLIPIGVVMPWLRNKYLGKLFS-------YEKRRL--- 235
            .||...|:......::.:||.......:|...|     :|.:...:|..       .|:||.   
  Rat   221 YITAILELSALVARRHQSLLLYVDLFYHLTRDG-----MRFRKACRLVHDFTDAVIRERRRTLPD 280

  Fly   236 ---EAATQSNAFIK--DIIDKKLSSTDNSSEPALIDRILNLVRIGELSYDDVMGEFSNIIFAASD 295
               :.|.::.|..|  |.||..|.|.|...|              .||.:|:..|....:|...|
  Rat   281 QGGDDALKAKAKAKTLDFIDVLLLSKDEHGE--------------ALSDEDIRAEADTFMFGGHD 331

  Fly   296 TLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVKLDRVLHETMRLIPAVP 360
            |.:..::.:|..:|..|:||:...:|:.|:.......|....||.:|..|...:.|::||.|...
  Rat   332 TTASGLSWILYNLAKHPEYQERCRQEVRELLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPAT 396

  Fly   361 LLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRARPPYSYLP 425
            .:.|..:..|.|.:|..||:||...|.||.||.|..:| |....:||..|..:|...|.|.:::|
  Rat   397 AISRCCTQDIMLPDGRVIPKGVICRISIFGTHHNPAVW-PDPEVYNPFRFDADNGEGRSPLAFIP 460

  Fly   426 FSKGKKTCLGWKLSLISAKLALAKILRNY 454
            ||.|.:.|:|...::...|:|||..|..:
  Rat   461 FSAGPRNCIGQTFAMSEMKVALALTLLRF 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 106/419 (25%)
Cyp4f18NP_001028858.2 CYP4F 74..515 CDD:410772 106/419 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.